DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Rnf19a

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_038935442.1 Gene:Rnf19a / 362900 RGDID:1307807 Length:861 Species:Rattus norvegicus


Alignment Length:359 Identity:85/359 - (23%)
Similarity:143/359 - (39%) Gaps:90/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DSHRSLLT------HMSCENDSDSEDTCTEILLPENSNSPETEDFVYKVLSVDQIVQHQRNI--- 69
            ||...|::      |....:|.|.:.:.:.:.||....:|:.     :.:|:..:.:.:::.   
  Rat    21 DSDSVLMSILDMSLHQQMGSDRDLQSSASSVSLPSVKKAPKK-----RRISIGSLFRRKKDNKRK 80

  Fly    70 -------IDEVNNVLNLPPQVTRIILNHFKWDKESLF------ENYFESNPK---DFFQRAHVLN 118
                   :|.:.::.::..:|..        :|.|:|      :|...|..|   ||.:      
  Rat    81 SRELTGGVDGIASIESIRSEVCA--------EKNSIFSTNASSDNGLTSISKQIGDFIE------ 131

  Fly   119 PFEKKIERESAASTSCAIPQLCGICFC--SCDELIG-LGCGHNFCAACWKQYLANKTCSEGLANT 180
                                 |.:|..  |.|.... :.|.|..|..|.:|||..: .||...| 
  Rat   132 ---------------------CPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIE-ISESRVN- 173

  Fly   181 IKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV-CAEP 244
            |.||  .|....:......:..|..::|:|::.:...::..:...||||||:|.:||.|. ||..
  Rat   174 ISCP--ECTERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASC 236

  Fly   245 RAVLC---KCGHEFCFACGENWHEPASCSS----------LKKWVKKCLEDSETSNWIAQNTKEC 296
            ..:.|   .||.|||:.|.:.||...:|.:          |:......:..|:.|...|.:.|.|
  Rat   237 PKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKPC 301

  Fly   297 PKCNVTIEK--DGGCNHMVCKNPSCRYDFCWVCL 328
            |:|...|.|  ||.||||.|  ..|..:|||:|:
  Rat   302 PRCAAYIIKMNDGSCNHMTC--AVCGCEFCWLCM 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 23/64 (36%)
IBR 273..331 CDD:279784 21/58 (36%)
Rnf19aXP_038935442.1 RING-HC_RBR_RNF19A 131..185 CDD:319689 18/84 (21%)
IBR 199..264 CDD:214763 23/64 (36%)
IBR <297..335 CDD:396187 18/39 (46%)
AzlC <361..450 CDD:412452
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.