DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and RNF144B

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_877434.2 Gene:RNF144B / 255488 HGNCID:21578 Length:303 Species:Homo sapiens


Alignment Length:210 Identity:67/210 - (31%)
Similarity:92/210 - (43%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CGICFC--SCDELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANC----EILVDYISF 197
            |.:|.|  |.|::..| .|...||.||.|||: .....||..:.|.||...|    .:....|:.
Human    30 CKLCLCEQSLDKMTTLQECQCIFCTACLKQYM-QLAIREGCGSPITCPDMVCLNHGTLQEAEIAC 93

  Fly   198 LKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-------AEPRAVLC-KCGHE 254
            |...|..::   ||:|.....|..:....|||..:|    :.||       .:|..|.| .|..:
Human    94 LVPVDQFQL---YQRLKFEREVHLDPYRTWCPVADC----QTVCPVASSDPGQPVLVECPSCHLK 151

  Fly   255 FCFACGENWHEPASCSSLKKWV----KKCL--EDSETSNWIAQNTKECPKCNVTIEKDGGCNHMV 313
            ||..|.:.||...||...:..|    .:.|  .|:|..      .|:||.|.|.||::.||..|:
Human   152 FCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAP------IKQCPVCRVYIERNEGCAQMM 210

  Fly   314 CKNPSCRYDFCWVCL 328
            |||  |::.|||.||
Human   211 CKN--CKHTFCWYCL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 19/68 (28%)
IBR 273..331 CDD:279784 23/62 (37%)
RNF144BNP_877434.2 TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 26..244 67/210 (32%)
mRING-HC-C4C4_RBR_RNF144B 28..84 CDD:319692 20/54 (37%)
IBR 101..166 CDD:214763 19/71 (27%)
IBR <190..225 CDD:396187 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.