DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Rbck1

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001077390.1 Gene:Rbck1 / 24105 MGIID:1344372 Length:508 Species:Mus musculus


Alignment Length:274 Identity:61/274 - (22%)
Similarity:100/274 - (36%) Gaps:61/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LNHFKWDKESLFE-NYFESNPKDFFQRAHVLNPFEKKIERESAASTSCAIPQLCGICF---CSCD 148
            |..::..|:...| ||.:....:  ||:.|||                ..|..|.:|:   ...:
Mouse   245 LRQYQQRKQQQQEGNYLQHVQLE--QRSLVLN----------------TEPTECPVCYSVLAPGE 291

  Fly   149 ELIGLGCGHNFCAACWKQYLANKTCSE----GLANTIKCPAANCEILVDYISFLKLADDSEVVER 209
            .::...|.|.||..|.:..:.|...:|    .:.:|..||.   ::|...|..|...:|   .:|
Mouse   292 AVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPG---KLLEREIRALLSPED---YQR 350

  Fly   210 YQQLITNTFVECNMLMRWCPAPNC----------SHAVKAVCAEPRAVLCKCGHEFCFACGENWH 264
            :..|..:.....:.|...|..|:|          :.....||.....:|||..||. ..|.|...
Mouse   351 FLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEH-MNCREYQD 414

  Fly   265 EPA-------SCSSLKKWVKKCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYD 322
            :.|       :.....:.:|..|:..|..:        ||:|.:.::|..||:.:.|  ..|..:
Mouse   415 DLALRAQNDVAARQTTEMLKVMLQQGEAMH--------CPQCRIVVQKKDGCDWIRC--TVCHTE 469

  Fly   323 FCWVCLG-SWEPHG 335
            .|||..| .|.|.|
Mouse   470 ICWVTKGPRWGPGG 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 16/77 (21%)
IBR 273..331 CDD:279784 15/58 (26%)
Rbck1NP_001077390.1 Interaction with TAB2. /evidence=ECO:0000250|UniProtKB:Q9BYM8 1..268 5/24 (21%)
Interaction with IRF3. /evidence=ECO:0000250|UniProtKB:Q9BYM8 1..218
Hoil1_N 57..131 CDD:176394
Interaction with RNF31. /evidence=ECO:0000250|UniProtKB:Q9BYM8 69..131
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..191
ZnF_RBZ 195..215 CDD:197784
RanBP2-type Zn finger 195..214 CDD:275376
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 276..504 51/225 (23%)
zf-RING_UBOX 280..322 CDD:290181 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.