DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Rnf144b

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001164114.1 Gene:Rnf144b / 218215 MGIID:2384986 Length:301 Species:Mus musculus


Alignment Length:215 Identity:65/215 - (30%)
Similarity:97/215 - (45%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CGICFC--SCDELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANC----EILVDYISF 197
            |.:|.|  |.|::..| .|...||..|.|||:. .:..||..:.|.||...|    .:....|:.
Mouse    30 CKLCLCEQSLDKMTMLQECQCIFCTPCLKQYMV-LSIREGCGSPITCPDMVCLNHGTLQETEIAC 93

  Fly   198 LKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-------AEPRAVLC-KCGHE 254
            |...|:.::   ||:|.....|..:.|..|||..:|    :.||       .:|..|.| .|..:
Mouse    94 LVPLDEFQL---YQRLKFEREVHMDPLRTWCPVADC----QTVCHISAGDPGQPVLVECPSCHLK 151

  Fly   255 FCFACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQN-----------TKECPKCNVTIEKDGG 308
            ||..|.:.|||.:||           .||:::  :.::           .|:||.|.:.||::.|
Mouse   152 FCSCCKDAWHEESSC-----------RDSQSA--MPEHGALFGTDADAPIKQCPVCRIYIERNEG 203

  Fly   309 CNHMVCKNPSCRYDFCWVCL 328
            |..|:|||  |::.|||.||
Mouse   204 CAQMMCKN--CKHTFCWYCL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 21/68 (31%)
IBR 273..331 CDD:279784 20/67 (30%)
Rnf144bNP_001164114.1 TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 26..242 65/215 (30%)
IBR 101..166 CDD:214763 21/71 (30%)
IBR <183..223 CDD:279784 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.