DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and C17H11.6

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001123112.1 Gene:C17H11.6 / 181076 WormBaseID:WBGene00015926 Length:893 Species:Caenorhabditis elegans


Alignment Length:329 Identity:81/329 - (24%)
Similarity:120/329 - (36%) Gaps:98/329 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DSDSEDTCTEILLPENSNSPETEDFVYKVLSVDQIVQHQRNIIDEVNNVLNLPPQVTRIILNHFK 92
            ||::.:||.|:||...:...|.:.                   ||.....:||            
 Worm   147 DSEAGETCAEMLLSSRNQDDEEQS-------------------DEKQLSQSLP------------ 180

  Fly    93 WDKESLFENYFESNPKDFFQRAHVLNPFE--KKIERESAASTSCAIPQLCGICFCSCDELIGLGC 155
                        ..||         .|.|  ||.:.:......|| .::.|..|....     ||
 Worm   181 ------------DTPK---------TPSEVGKKGKGKMKECPLCA-AKMPGSAFPKLK-----GC 218

  Fly   156 GHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLK-------LADDSEVVERYQQL 213
            .|..|.||.:||: ..:.:|   |.::.|...|.      |:|.       :.|...::|:|:..
 Worm   219 QHRSCRACLRQYV-ELSITE---NRVEVPCPECS------SYLHPNDIKMLIGDIPTLIEKYEAF 273

  Fly   214 ITNTFVECNMLMRWCPAPNCSHA-VKAVCAEPRAVLCK---CGHEFCFACGENWHEPASCSSLKK 274
            ....::......||||||:|... :...||....:.|:   ||..||:.|...||...:|...::
 Worm   274 SLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARR 338

  Fly   275 WVKK-----CLED--------SETSNWIAQNTKECPKCNVTIEK--DGGCNHMVCKNPSCRYDFC 324
            ..|:     ..|:        |..|.....:.|.||:|...|.|  ||.||||||  ..|..:||
 Worm   339 PEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVC--TMCNAEFC 401

  Fly   325 WVCL 328
            |:||
 Worm   402 WLCL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 19/64 (30%)
IBR 273..331 CDD:279784 24/71 (34%)
C17H11.6NP_001123112.1 IBR 268..333 CDD:214763 19/64 (30%)
IBR <369..407 CDD:279784 20/39 (51%)
AzlC <433..529 CDD:294385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.