DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and tag-314

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_872234.4 Gene:tag-314 / 179455 WormBaseID:WBGene00008871 Length:404 Species:Caenorhabditis elegans


Alignment Length:325 Identity:68/325 - (20%)
Similarity:111/325 - (34%) Gaps:114/325 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DKESLFENYFESNPKDFFQRAHVLN--PFEKKIERESAAST--SCAIPQLCGICFCSCDE--LIG 152
            ||.|      |:|....||..:..|  |.:..::.:....|  .|   :||.|    .||  :|.
 Worm     3 DKVS------ENNDIKGFQLTNRENEQPMDLNLKEKKPTFTIVGC---ELCQI----KDEIRIIL 54

  Fly   153 LGCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLADDSE-VVERYQQLITN 216
            ..|||..|..|..:|:.||...:|... .|||.:.|..:|.......:.|:.| .:|||..::..
 Worm    55 RQCGHVVCLPCVLEYIKNKIIVDGHPR-FKCPLSTCNAVVHENDINAVLDEKEPALERYMSIVHR 118

  Fly   217 TFVECNMLMRWCPAPNCSHAVKAVCAEPRAVLCKCGHEFCFACGENWHEPASCSSLKKWVKKCLE 281
            .:::..         ...|::.|..                        |:|             
 Worm   119 RYLQYK---------QNKHSIMAAL------------------------PSS------------- 137

  Fly   282 DSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGSWEPHG--SSWYSCNRF 344
                      :.|.||.|........|||:::|.|.:|...|||:|   .:|.|  ||.::    
 Worm   138 ----------DIKRCPLCRSIYMHVVGCNYVICANSACNTAFCWLC---EKPMGRPSSHFT---- 185

  Fly   345 DEEEAKQARLAQQKYRSSMARYLHYYNRYSNHMQSLKMENKLYSNIQAKMDDMQEEMSWIEVQFL 409
               .|.:.||....|                        .:::.:||..: |:...:.||.:.|:
 Worm   186 ---TASKCRLGYTDY------------------------ERIFRSIQLIL-DVNFVILWILLPFV 222

  Fly   410  409
             Worm   223  222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 6/60 (10%)
IBR 273..331 CDD:279784 14/57 (25%)
tag-314NP_872234.4 InsA 48..>90 CDD:226202 15/42 (36%)
IBR 119..176 CDD:279784 18/115 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.