DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and pdr-1

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001370029.1 Gene:pdr-1 / 176816 WormBaseID:WBGene00003967 Length:386 Species:Caenorhabditis elegans


Alignment Length:260 Identity:68/260 - (26%)
Similarity:94/260 - (36%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KIERESAASTSCAIPQL-------CGIC------------------FCSCD----ELIGLGCGHN 158
            |.:|..|....|..|.|       |..|                  .|.||    .:..|||.|.
 Worm   145 KSKRIPAVCEECCTPGLFAEFKFKCLACNDPAAALTHVRGNWQMTECCVCDGKEKVIFDLGCNHI 209

  Fly   159 FCAACWKQYLANKTCSEGLAN------TIKCPAANCEILVDYISFLKLADDSEVVERYQQLITNT 217
            .|..|::.||.::....|..|      ||.||...|..:|..:....:...:...| ||:..|..
 Worm   210 TCQFCFRDYLLSQLERFGFVNQPPHGFTIFCPYPGCNRVVQDVHHFHIMGQTSYSE-YQRKATER 273

  Fly   218 FVECNMLMRWCPAPNCSHAVKAVCAEP-----RAVLCKCGHEFCFACGENWHEPASCSSLKKWVK 277
            .:..:.....||..:|.   ::...||     |:....|...||..|.|   ....|.|      
 Worm   274 LIAVDDKGVTCPNVSCG---QSFFWEPYDDDGRSQCPDCFFSFCRKCFE---RNCVCQS------ 326

  Fly   278 KCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGSW--EPHGSSWYS 340
               ||..|...|...|:.||||:|..|::|||.|:.|  .||..|:|:.|...|  |.....|::
 Worm   327 ---EDDLTRTTIDATTRRCPKCHVATERNGGCAHIHC--TSCGMDWCFKCKTEWKEECQWDHWFN 386

  Fly   341  340
             Worm   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 15/65 (23%)
IBR 273..331 CDD:279784 21/57 (37%)
pdr-1NP_001370029.1 Ubl_ubiquitin_like 13..77 CDD:340559
RING0_parkin 104..182 CDD:412057 8/36 (22%)
zf-RING_14 182..268 CDD:407824 21/86 (24%)
IBR 266..317 CDD:418646 12/53 (23%)
IBR <336..375 CDD:396187 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.