Sequence 1: | NP_648392.1 | Gene: | CG12362 / 39193 | FlyBaseID: | FBgn0036082 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001370029.1 | Gene: | pdr-1 / 176816 | WormBaseID: | WBGene00003967 | Length: | 386 | Species: | Caenorhabditis elegans |
Alignment Length: | 260 | Identity: | 68/260 - (26%) |
---|---|---|---|
Similarity: | 94/260 - (36%) | Gaps: | 60/260 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 KIERESAASTSCAIPQL-------CGIC------------------FCSCD----ELIGLGCGHN 158
Fly 159 FCAACWKQYLANKTCSEGLAN------TIKCPAANCEILVDYISFLKLADDSEVVERYQQLITNT 217
Fly 218 FVECNMLMRWCPAPNCSHAVKAVCAEP-----RAVLCKCGHEFCFACGENWHEPASCSSLKKWVK 277
Fly 278 KCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGSW--EPHGSSWYS 340
Fly 341 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12362 | NP_648392.1 | IBR | 208..269 | CDD:214763 | 15/65 (23%) |
IBR | 273..331 | CDD:279784 | 21/57 (37%) | ||
pdr-1 | NP_001370029.1 | Ubl_ubiquitin_like | 13..77 | CDD:340559 | |
RING0_parkin | 104..182 | CDD:412057 | 8/36 (22%) | ||
zf-RING_14 | 182..268 | CDD:407824 | 21/86 (24%) | ||
IBR | 266..317 | CDD:418646 | 12/53 (23%) | ||
IBR | <336..375 | CDD:396187 | 17/40 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |