DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and RNF19B

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_699172.2 Gene:RNF19B / 127544 HGNCID:26886 Length:732 Species:Homo sapiens


Alignment Length:251 Identity:67/251 - (26%)
Similarity:103/251 - (41%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PFEKKIERESAASTSCAIPQL-----------------CGICFCSCDELIG---------LGCGH 157
            |.|...|.|:.|:.:.|.|..                 |.:|      |:.         |.|.|
Human    81 PAEPAAEAEAEAAAAAAEPGFDDEEAAEGGGPGAEEVECPLC------LVRLPPERAPRLLSCPH 139

  Fly   158 NFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECN 222
            ..|..|.:.||..:.....:  .|.||  .|...::......|..|..::.:|::.:...::..:
Human   140 RSCRDCLRHYLRLEISESRV--PISCP--ECSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASD 200

  Fly   223 MLMRWCPAPNCSHAVKAV-CAEPRAVLCK---CGHEFCFACGENWHEPASCSSLKKWVKKCL--E 281
            ...||||||:|.:||.|. ||....:.|:   |..|||:.|.:.||...:|...::...:.|  .
Human   201 PDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVR 265

  Fly   282 DSETS-------NWIAQNTKECPKCNVTIEK--DGGCNHMVCKNPSCRYDFCWVCL 328
            ...||       :..|.:.|.||:|:..|.|  ||.||||.|  ..|..:|||:|:
Human   266 TKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCNHMTC--AVCGCEFCWLCM 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 21/64 (33%)
IBR 273..331 CDD:279784 22/67 (33%)
RNF19BNP_699172.2 Required for ubiquitin ligase activity and for protection against staurosporin-induced cell death. /evidence=ECO:0000269|PubMed:27485036 1..318 66/248 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 7/30 (23%)
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 115..337 60/217 (28%)
zf-RING_2 118..166 CDD:290367 13/57 (23%)
IBR 187..251 CDD:214763 21/63 (33%)
IBR <283..321 CDD:279784 18/39 (46%)
AzlC <347..436 CDD:294385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..732
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.