DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Rnf144a

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006515007.1 Gene:Rnf144a / 108089 MGIID:1344401 Length:313 Species:Mus musculus


Alignment Length:225 Identity:72/225 - (32%)
Similarity:91/225 - (40%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANTIKCPAANC-----------EIL 191
            |:..|..|.|          .||..|.|||: .....|||...|.||.|.|           |.:
Mouse    52 QMTTIAQCQC----------IFCTLCLKQYV-ELLIKEGLETAISCPDAACPKQGHLQENEIECM 105

  Fly   192 VDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-------AEPRAVLC 249
            |          .:|:::||::|.....|..:....||||..|    :|||       ..|:.|.|
Mouse   106 V----------AAEIMQRYKKLQFEREVLFDPCRTWCPASTC----QAVCQLQDIGLQTPQLVQC 156

  Fly   250 K-CGHEFCFACGENWHE-------------PASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCN 300
            | |..|||.||...||.             |...||..|     :|:.:..      .|.||||.
Mouse   157 KACDMEFCSACKARWHPGQGCPETMPITFLPGETSSAFK-----MEEGDAP------IKRCPKCR 210

  Fly   301 VTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330
            |.||:|.||..|:|||  |::.|||.||.|
Mouse   211 VYIERDEGCAQMMCKN--CKHAFCWYCLES 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 25/81 (31%)
IBR 273..331 CDD:279784 24/58 (41%)
Rnf144aXP_006515007.1 mRING-HC-C4C4_RBR_RNF144A 40..93 CDD:319691 18/51 (35%)
IBR 112..177 CDD:214763 24/68 (35%)
IBR <200..237 CDD:366672 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.