DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf144b

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_031759023.1 Gene:rnf144b / 100124330 XenbaseID:XB-GENE-1010811 Length:337 Species:Xenopus tropicalis


Alignment Length:214 Identity:66/214 - (30%)
Similarity:87/214 - (40%) Gaps:44/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LCGICFCS--CDELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKL 200
            ||.:|.|.  .|::..| .|...||.:|.|||: .....||..:.|.||...|    .....|:.
 Frog    63 LCKLCLCEHPFDKMTSLQACSCIFCTSCLKQYI-QFAIREGFGSPITCPNTVC----TNQGILQE 122

  Fly   201 ADDS-----EVVERYQQLITNTFVECNMLMRWCPAPNC---SHAVKAVCAEPRAVLCK-CGHEFC 256
            |:.|     |.::.||:|.....|..:....|||..:|   .|........|..|.|. |..:||
 Frog   123 AEISALVPVEQLQLYQRLKLEREVHMDPCKTWCPTVDCHTVCHVETGDSGLPVPVDCSACLIKFC 187

  Fly   257 FACGENWHEPASCS------------SLKKWVKKCLEDSETSNWIAQNTKECPKCNVTIEKDGGC 309
            ..|...||...||.            .|.|.|..|:             |:||.|.:.||::.||
 Frog   188 SVCKNIWHPGQSCQVNLPIIPPEKGILLTKDVDACI-------------KQCPVCRIYIERNEGC 239

  Fly   310 NHMVCKNPSCRYDFCWVCL 328
            ..|:|||  ||:.|||.||
 Frog   240 AQMMCKN--CRHTFCWYCL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 18/64 (28%)
IBR 273..331 CDD:279784 22/56 (39%)
rnf144bXP_031759023.1 mRING-HC-C4C4_RBR_RNF144B 62..118 CDD:319692 19/59 (32%)
IBR 135..197 CDD:396187 18/61 (30%)
IBR <220..258 CDD:396187 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.