DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf144a

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001095278.1 Gene:rnf144a / 100124307 XenbaseID:XB-GENE-962808 Length:292 Species:Xenopus tropicalis


Alignment Length:227 Identity:71/227 - (31%)
Similarity:93/227 - (40%) Gaps:70/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IPQLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANTIKCPAANC-----------E 189
            :.|:..|..|.|          .||..|.|||: .....|||...|.||.|:|           |
 Frog    29 VEQMTTIAQCQC----------IFCTLCLKQYV-ELLIKEGLETAISCPDASCPKRGHLQENEIE 82

  Fly   190 ILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-------AEPRAV 247
            .:|          .:|::::|::|.....:..:....|||:.:|    :|||       ..|:.|
 Frog    83 CMV----------AAEIMQKYKKLQFEKEILLDPCRTWCPSSSC----QAVCKLQEKGIQNPQLV 133

  Fly   248 LCK-CGHEFCFACGENWHE-------------PASCSSLKKWVKKCLEDSETSNWIAQNTKECPK 298
            .|. |..|||.||..|||.             |...||.    .|.|||...       .|.|||
 Frog   134 QCSACDIEFCSACKANWHPGQGCPENMAITFLPGDSSSF----FKSLEDDVP-------IKRCPK 187

  Fly   299 CNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330
            |.|.||:|.||..|:|||  |::.|||.||.|
 Frog   188 CKVYIERDEGCAQMMCKN--CKHAFCWYCLES 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 22/81 (27%)
IBR 273..331 CDD:279784 26/58 (45%)
rnf144aNP_001095278.1 TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 16..236 71/227 (31%)
RING_Ubox 19..72 CDD:327409 18/53 (34%)
IBR 91..156 CDD:214763 21/68 (31%)
IBR 174..216 CDD:307574 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.