DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or98b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:65/177 - (36%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LCDL--LVWHQLYTRMLQTTKKIYSIVLFV-QLSTTCVGL---------------------LCTI 286
            ||.|  :..|::.....:.||:.:..:..| ||...|:.|                     ||.:
  Fly   209 LCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVL 273

  Fly   287 SCIFMKAWPAAPLYLLYAAIT--------LYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEE 343
             |..:.|....|..|.|||.|        :|.||  |:.:.:..:.|...||.:. |..|..:..
  Fly   274 -CYQLSANILQPALLFYAAFTAAVVGQVSIYCFC--GSSIHSECQLFGQAIYESS-WPHLLQENL 334

  Fly   344 KL-----IIMMLA-----------KAQNEVVLTAADMAPLSMNTALQ 374
            :|     |.||.:           :|..|.::|....| :|..|.|:
  Fly   335 QLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTA-ISYVTLLR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 41/177 (23%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.