DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or85d

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:418 Identity:81/418 - (19%)
Similarity:156/418 - (37%) Gaps:65/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVEPVERYCKVIRMIRFCVGFCGNDVADPNFRMW------WLTYAVMAAIAFFFACTGYTIYVGV 64
            |..|:..:.|...:....:|....|  ....:.|      |...|.|  :..........|||.:
  Fly    17 KAIPLHSFLKYANVFYLSIGMMAYD--HKYSQKWKEVLLHWTFIAQM--VNLNTVLISELIYVFL 77

  Fly    65 VINGDLTIILQA---LAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYRE------------Y 114
            .| |..:..|:|   |:.:|..:.|..|:...:.....:.:|.:..|:::.:            :
  Fly    78 AI-GKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEPYNIGHH 141

  Fly   115 GSKGDEYAK-CLEKRIRITWTLLIGFMLVYIILLGLVITFPIFYL-LILHQKVLVMQFLIPFLDH 177
            .|....|:| .....:.:.||..:.:.:.|::.        .|:| :...:::|.....:|: |.
  Fly   142 LSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVC--------DFWLGMRQFERMLPYYCWVPW-DW 197

  Fly   178 TTDGGHLILTAAHVILITFGG----FGNYGGDMYLFLFVTHVPLIKDIFCVKLTEFNEL-VMKRN 237
            :|...:..:..:..|    ||    .|....||.:...||.|.:    ..::|:...|. |....
  Fly   198 STGYSYYFMYISQNI----GGQACLSGQLAADMLMCALVTLVVM----HFIRLSAHIESHVAGIG 254

  Fly   238 DFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVL---FVQLS-TTC-VGLLCTISC----IFMKA 293
            .|......|...:.:||....:.|...:|:.:.|   ||..| ..| ||...||..    :.|..
  Fly   255 SFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVMLV 319

  Fly   294 WPAAPLYLLYAAITLYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVV 358
                 |:|..|.:.::........:.:::|.....:| |..|:...::..|::|:::.:||....
  Fly   320 -----LFLFCAMVQVFMIATHAQRLVDASEQIGQAVY-NHDWFRADLRYRKMLILIIKRAQQPSR 378

  Fly   359 LTAADMAPLSMNTALQLTKGIYSFSMML 386
            |.|.....:|:.|...|.:..|.|..:|
  Fly   379 LKATMFLNISLVTVSDLLQLSYKFFALL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 64/341 (19%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 64/338 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.