DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or85a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:391 Identity:78/391 - (19%)
Similarity:151/391 - (38%) Gaps:95/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WWLTY-----------------AVMAAIAFF--FACTGYTIYVGVVINGDLTII----------- 73
            |||.|                 .:|..|..|  |..|....||.|.:|.:.:|:           
  Fly    43 WWLYYIWTLVVIVLVFIFIPYGLIMTGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMRRR 107

  Fly    74 -LQALAMVGSAVQGLTKL--LVTANNASHM-REVQNTYEDIYREYGSKGDEYAKCLEKRIRITWT 134
             .:|..|:.:.....||:  .|..:.|:.: ..|...|..||..|.|            :.:|..
  Fly   108 FSRAQKMMDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCIYFGYLS------------MALTGA 160

  Fly   135 LLIGFMLVYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGF 199
            |:|| ...:.:...||.....|||....:.|.:...::                |::||      
  Fly   161 LVIG-KTPFCLYNPLVNPDDHFYLATAIESVTMAGIIL----------------ANLIL------ 202

  Fly   200 GNYGGDMYLFLFVTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTK 264
                 |:|..::|..:.:..::...::......|.|.:|  :..|.|.:.:..|:|......|.:
  Fly   203 -----DVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDD--QHYAELVECVKDHKLIVEYGNTLR 260

  Fly   265 KIYSIVLFVQLSTTCVGLLCTISCIFMKAW------PAAPLYLLYAAITLYTFCGLGTLVENSNE 323
            .:.|..:|:||.:  ||||..::.:.|:.:      ..:.:|.:......:.||   .:.|..:.
  Fly   261 PMISATMFIQLLS--VGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFC---YVCEQLSS 320

  Fly   324 DFLSVIYTNCLWYELPVKEEK----LIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSM 384
            |..|:  ||.|::...:..|:    .::..:...|..::.||..:.|:.:||.:::.|  ::||:
  Fly   321 DCESL--TNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAK--FAFSV 381

  Fly   385 M 385
            :
  Fly   382 V 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 63/335 (19%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 68/352 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.