DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or83a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:448 Identity:85/448 - (18%)
Similarity:148/448 - (33%) Gaps:129/448 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MIRFCVGFCGNDVADPNFRMWWLTYAVMAAIAFFFACTGYTIYVGVVINGDL---------TII- 73
            ::|||         |..:.::  .|.|...||..:.||.|..|.    .|||         ||| 
  Fly    48 LVRFC---------DLTYELF--NYFVSVHIAGLYICTIYINYG----QGDLDFFVNCLIQTIIY 97

  Fly    74 LQALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYREYGSKGDEYAKCL-EKRIRITWTLLI 137
            |..:||         ||.........:..:.:...|.|....:.|..:.... ..|:...|..  
  Fly    98 LWTIAM---------KLYFRRFRPGLLNTILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIK-- 151

  Fly   138 GFMLVYIILLGLV--ITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGH---LILTAAHVILITFG 197
              ..||...:|.:  :..||.|    ..:.|.:....|| |:|..|.:   .:|.|...|.:. .
  Fly   152 --TYVYCCYIGTIFWLALPIAY----RDRSLPLACWYPF-DYTQPGVYEVVFLLQAMGQIQVA-A 208

  Fly   198 GFGNYGGDMYLFLFVTHVPLIKDIFC--------------VKLTEFNELVMKRN----------- 237
            .|.:..| :::.|.|........:||              ..:||.|:|..:::           
  Fly   209 SFASSSG-LHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAY 272

  Fly   238 ------------------DFPKV-RAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLL 283
                              ||... |......:..|:.....|:..:..||.:.||::..... |:
  Fly   273 SVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTF-LM 336

  Fly   284 CTISCIFMKAWPAAPL--------YLLYAAITLYTFCGLGTLVENSNEDFLSVIYTN------CL 334
            |.::.:..|:..|...        |||.....|:..|           .|..:::.|      .|
  Fly   337 CLVAFVSTKSTAANSFMRMVSLGQYLLLVLYELFIIC-----------YFADIVFQNSQRCGEAL 390

  Fly   335 W------YELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMML 386
            |      :...|:.:.:..|:.::.|.:  |||..::.|:::.........:||..:|
  Fly   391 WRSPWQRHLKDVRSDYMFFMLNSRRQFQ--LTAGKISNLNVDRFRGTITTAFSFLTLL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 69/390 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 53/305 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.