DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or67b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:412 Identity:76/412 - (18%)
Similarity:159/412 - (38%) Gaps:71/412 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RYCKVIRMIRFCVGFCGNDVADPNFRMWWLTYAVMAAIAFFFACTGYTIYVGVVINGDLTIILQA 76
            :||::.|::...|...             :.|:::|.|...:..:..|....|::...|::.:..
  Fly    42 KYCRLTRILVLIVNLS-------------IIYSLVAFIMENYMISFETYVEAVLLTFQLSVGVVK 93

  Fly    77 LAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYREYGSKGDEYAKCLEKRIRITWTLLIGFML 141
            :....:.|:..::|:.:......::.:.....|:.|:           .|....::..||..:|:
  Fly    94 MFHFQNKVESCSQLVFSTETGEVLKSLGLFQLDLPRK-----------KELLSSVSLILLNNWMI 147

  Fly   142 V--YIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGG 204
            :  .::....::..|:.|..:..    ..|::  |..:..|.....:|..:..::.:...|||..
  Fly   148 IDRQVMFFFKIVCMPVLYYCVRP----YFQYI--FDCYIKDKDTCEMTLTYPAIVPYLQLGNYEF 206

  Fly   205 DMYL--FLFVTHVPL--------IKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRM 259
            ..|:  |..:...||        ...:|.| ||.:...::|...| .|:....|:||......:.
  Fly   207 PSYVIRFFLLQSGPLWCFFAVFGFNSLFVV-LTRYESGLIKVLRF-LVQNSTSDILVPKDQRVKY 269

  Fly   260 LQ--------------TTKKIYSIVLFVQLSTTCVGLLC----TISCIFMKAWPAAPLYLLY--- 303
            ||              ..:.::..::.||.|.:.: |:|    .||.:....|....:.::|   
  Fly   270 LQCCVRLFARISSHHNQIENLFKYIILVQCSVSSI-LICMLLYKISTVLEVGWVWMGMIMVYFVT 333

  Fly   304 --AAITLYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAP 366
              ..||||...  ...||:.:| .|...:.||.||....:.:.:|.|||..::...||:......
  Fly   334 IALEITLYNVS--AQKVESQSE-LLFHDWYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTS 395

  Fly   367 LSMNTALQLTKGIYSFSMMLMN 388
            ||....:|:.:...:|.::|.|
  Fly   396 LSHKFLVQVFRLSANFFLLLRN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 64/345 (19%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 49/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.