DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or59b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:396 Identity:80/396 - (20%)
Similarity:155/396 - (39%) Gaps:82/396 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FRMWWL------TYAVMAAIAFFFACTGYT-----IYVGVVIN----------GD-LTIILQALA 78
            :|..||      ...|:..:..|:.|..:.     :.||.:|:          |: ||.:...:.
  Fly    26 YRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYVQEFKNFTPGEFLTSLQVCIN 90

  Fly    79 MVGSAVQG-LTKLLVTANNASHMREVQNTYEDIYREYGSKGDEYAKCLEKRI-----RITWTLLI 137
            :.|::|:. :|.|.:.     .:|:.:...:.:.:...:..|      .:||     |..:..||
  Fly    91 VYGASVKSTITYLFLW-----RLRKTEILLDSLDKRLANDSD------RERIHNMVARCNYAFLI 144

  Fly   138 GFMLVYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAA-HVILITFGGFGN 201
             :..:|....|  .|| :.|.|.......|..   ||:|.....|.|.:.|. ..|.::|....:
  Fly   145 -YSFIYCGYAG--STF-LSYALSGRPPWSVYN---PFIDWRDGMGSLWIQAIFEYITMSFAVLQD 202

  Fly   202 YGGD----MYLFLFVTHVPLIKDIFCVKLTEFNELVM--KRNDFPKVRAMLCDLLVWHQLYTRML 260
            ...|    |:..:|..|:.::||       ....|.|  :|::....:. |.:.::.|:...:..
  Fly   203 QLSDTYPLMFTIMFRAHMEVLKD-------HVRSLRMDPERSEADNYQD-LVNCVLDHKTILKCC 259

  Fly   261 QTTKKIYSIVLFVQ--LSTTCVGLLCTISCIFMKAWPAAPLYLLYAAITLYTF-----CGLGTLV 318
            ...:.:.|..:|||  |..:.:||.......|...|......|....|.|.||     |.:  |:
  Fly   260 DMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNM--LI 322

  Fly   319 EN----SNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGI 379
            ::    |||.|.|      .|.:...:.:..:::.:...|..::..|..:.|:|||:.:.:.|  
  Fly   323 DDAQDLSNEIFQS------NWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAK-- 379

  Fly   380 YSFSMM 385
            ::||::
  Fly   380 FAFSII 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 68/335 (20%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 69/340 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.