DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or56a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:401 Identity:91/401 - (22%)
Similarity:157/401 - (39%) Gaps:96/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WLTYAVMAAIAFFFACTGY-------TIYVGVVINGDLTIILQALAMVGSAVQ--GLTKLLVTAN 95
            ||:.|:|.|..|    .||       |.|...|     .....::||..:.||  .:..||..|:
  Fly    55 WLSCALMLARVF----RGYENLNDGATSYATAV-----QYFAVSIAMFNAYVQRDKVISLLRVAH 110

  Fly    96 NASHMREVQNTYEDIYREYGSKGDEYAKCLEKRIRITWTLLIGFMLVYIILLGLVITFPIFY-LL 159
            :     ::||    :..|..::..|.....:...| |.||||   .:..::.||:......| .|
  Fly   111 S-----DIQN----LMHEADNREMELLVATQAYTR-TITLLI---WIPSVIAGLMAYSDCIYRSL 162

  Fly   160 ILHQKVLVMQFLIPFL----DHTTDGGHLILTAAHVILITFGGFG--------NYGGDMY-LFLF 211
            .|.:.|    |.:|.:    :|.            ::|.....||        .|.|..| |.|.
  Fly   163 FLPKSV----FNVPAVRRGEEHP------------ILLFQLFPFGELCDNFVVGYLGPWYALGLG 211

  Fly   212 VTHVPLIKD-IFC------VKLTEFNELVMKRNDFPKVRAML-------CDLLVWH-QLYTRMLQ 261
            :|.:||... |.|      :||...|:.| :..|..::.:.|       .:|..|. ||:...::
  Fly   212 ITAIPLWHTFITCLMKYVNLKLQILNKRV-EEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVK 275

  Fly   262 TTKKIYSIVLFVQLSTTCVGLLC-------TISCIFMKAWPAAPLYLLYAAITLYTFCGLG---- 315
            ...:|...|..:|. ..||.::.       .|..:|.......|..:.|..:.:|.|...|    
  Fly   276 EQLRIRKFVQELQY-LICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWI 339

  Fly   316 -----TLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQL 375
                 ||:...::: ||:.|.:|.||...:..:|:::.|:..||..:.:.|. :..|::.|.:.:
  Fly   340 YHWHATLIVECHDE-LSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRAL-LVDLNLRTFIDI 402

  Fly   376 TKGIYSFSMML 386
            .:|.||:..:|
  Fly   403 GRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 77/357 (22%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 67/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.