DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or49b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:401 Identity:67/401 - (16%)
Similarity:127/401 - (31%) Gaps:143/401 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YEDIYREYGSKGDEYAKCLEKRIRITWTLLIGFMLVYIILLGLVITFPIF--------------- 156
            :|||...|          :..:|...|.||....|...:.:||. :|.||               
  Fly     2 FEDIQLIY----------MNIKILRFWALLYDKNLRRYVCIGLA-SFHIFTQIVYMMSTNEGLTG 55

  Fly   157 -----YLLIL--------------HQKVLVM----------------QFLIPFLDHTTDGGHLI- 185
                 |:|:|              |.:.|.:                .::...||.....|.|: 
  Fly    56 IIRNSYMLVLWINTVLRAYLLLADHDRYLALIQKLTEAYYDLLNLNDSYISEILDQVNKVGKLMA 120

  Fly   186 ------------------LTAAHVILITFG----GFGNYGGDMYLFLFVTHVPLIKDIFCVKLTE 228
                              |:::..:| .||    |...|....|...::..: ||..:.|.....
  Fly   121 RGNLFFGMLTSMGFGLYPLSSSERVL-PFGSKIPGLNEYESPYYEMWYIFQM-LITPMGCCMYIP 183

  Fly   229 FNELVMKRNDFPKVRA-----MLCDLLVWH--------QLYTRMLQTTKKIYSIVLFVQLSTTCV 280
            :..|::....|..||.     .|..:.:.|        :|...::...:...||:.::.    .:
  Fly   184 YTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMD----HI 244

  Fly   281 GLLCTISCIF-MKAWPAAPLYLLYAAITLYTFCGLGTLVENSNEDFLSVIYTNCL--------WY 336
            ..|.|:..:| :.|:.|....||:..|          :|..:::..:..:|.|.:        ||
  Fly   245 NELTTMMFLFELMAFSALLCALLFMLI----------IVSGTSQLIIVCMYINMILAQILALYWY 299

  Fly   337 ELPVKEEKL---------------------IIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIY 380
            ...::|:.|                     |:.|:.:||....:...::.|:::.....|....|
  Fly   300 ANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTY 364

  Fly   381 SFSMMLMNYLG 391
            :|..:|....|
  Fly   365 TFFTVLKRVYG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 63/388 (16%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 49/326 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.