DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or45b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:225 Identity:39/225 - (17%)
Similarity:81/225 - (36%) Gaps:48/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPL 217
            ||:|||                  ::|..|.          :|...|.  |.|.:.|.|..::..
  Fly   186 FPVFYL------------------YSTWSGQ----------VTVYAFA--GTDGFFFGFTLYMAF 220

  Fly   218 IKDIFCVKLTEFNELVMKRNDFPKVR------AMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLS 276
            :.......:.:    .:|....|.:|      ..|.|::..|....::::....|.:...||...
  Fly   221 LLQALRYDIQD----ALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFV 281

  Fly   277 TTCVGLLCTISCIFMKAWPAAPLYLLY-----AAITLYTFCGLGTLVENSNEDFLSVIYTNCLWY 336
            :..:.:..::..|.:.:......|::|     :||.||  |..||.:...:.......|::. ||
  Fly   282 SASLVIATSVIDILLYSGYNIIRYVVYTFTVSSAIFLY--CYGGTEMSTESLSLGEAAYSSA-WY 343

  Fly   337 ELPVKEEKLIIMMLAKAQNEVVLTAADMAP 366
            ....:..:.:.:::.:||..:.:.....||
  Fly   344 TWDRETRRRVFLIILRAQRPITVRVPFFAP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 39/225 (17%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 39/225 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.