DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or43b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:337 Identity:70/337 - (20%)
Similarity:139/337 - (41%) Gaps:53/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IILQALAMVGS----AVQGLTKLLVTANNASHMREVQNTYEDIYREYGSKGDEYAKCLEKRIRIT 132
            ::||:|.:..:    |::..|.::.|     |..|:.|.:.|...:|..|..|..|..:....||
  Fly    79 LLLQSLQLCLNTWCFALKFFTLIVYT-----HRLELANKHFDELDKYCVKPAEKRKVRDMVATIT 138

  Fly   133 WTLLIGFMLVYI------ILLGLV---ITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTA 188
             .|.:.|::||:      :|.||:   :.:..:|..|..:......::..||::.|.|     .|
  Fly   139 -RLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFTVG-----YA 197

  Fly   189 AHVILITFGGFGNYGGDMYLFLFV----THVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDL 249
            .:|...|         |.|..::|    ||:.|:||.........||   ..:|...:...|.|.
  Fly   198 IYVATAT---------DSYPVIYVAALRTHILLLKDRIIYLGDPSNE---GSSDPSYMFKSLVDC 250

  Fly   250 LVWHQLYTRMLQTTKKIYSIVLFVQ--LSTTCVGLLCTISCIFMKAWPAAPLYLLYAAITLYTF- 311
            :..|:.........:.|.|..:|.|  :..:.:|::.....:|........:.:...|:.|.|| 
  Fly   251 IKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQTFP 315

  Fly   312 ----CGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTA 372
                |  ..:|::..|  |:....:..|:....:.::.:|..|.|.|..:..||.::..:::.|.
  Fly   316 LCFYC--NAIVDDCKE--LAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATN 376

  Fly   373 LQLTKGIYSFSM 384
            :.:.|  ::|::
  Fly   377 INVAK--FAFTV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 69/331 (21%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 65/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.