DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or42b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:383 Identity:76/383 - (19%)
Similarity:139/383 - (36%) Gaps:74/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RMWWLTYAVMAAIAFFFACTGYTIYVGVVINGDLTIILQALAMVGSAV---------QGLTKLLV 92
            |..:||:.:|.    |..||.|.                .|..:||.:         :.||.|.|
  Fly    42 RYVYLTWTLMT----FVWCTTYL----------------PLGFLGSYMTQIKSFSPGEFLTSLQV 86

  Fly    93 TANNASHMREVQNTYEDIYREYGSKG-----DEYAKCLEKRIRI-------TWTLLIGFMLVYII 145
            ..|......:|..||..::|...:|.     |.....:|:|.:|       ....|| |..||..
  Fly    87 CINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLI-FTFVYCG 150

  Fly   146 LLGLVITFPIFYLLILHQKVLVMQFLIPFLD-HTTDGGHLILTAAHVILITFGG--FGNYGGDMY 207
            ..|..      ||..:.......|...||:| |  ||...:..|:.:..:...|  ..:...|.|
  Fly   151 YAGST------YLSSVLSGRPPWQLYNPFIDWH--DGTLKLWVASTLEYMVMSGAVLQDQLSDSY 207

  Fly   208 LFLFV----THVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYS 268
            ..::.    .|:.::::  .::....:|.:.:...:.::...:.|    |:|..|.....|.:..
  Fly   208 PLIYTLILRAHLDMLRE--RIRRLRSDENLSEAESYEELVKCVMD----HKLILRYCAIIKPVIQ 266

  Fly   269 IVLFVQLSTTCVGLLCTISCI----FMKAWPAAPLYLLYAAITLYT--FCGLGTLVENSNEDFLS 327
            ..:|.|.  ..:||:...:.|    |...|.....::....|.|.|  ||....|:....|....
  Fly   267 GTIFTQF--LLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTH 329

  Fly   328 VIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMM 385
            .|:.: .|.:...:.:..::..|...|..:|..|..:..:||::.:.:.|  ::||::
  Fly   330 AIFQS-NWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAK--FAFSVI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 66/344 (19%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 63/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.