DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or35a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:394 Identity:80/394 - (20%)
Similarity:154/394 - (39%) Gaps:67/394 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DPNFRMW--WLTYAVMAAIAFFF-----ACTGYTIYVGVVINGD--LTIILQALAMVGSAVQGLT 88
            ||:...|  :|...:..|::..|     |...|..:.....|.|  ||.:...|.:|.:..:.|.
  Fly    33 DPSTGKWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYLILVEAQFRSLH 97

  Fly    89 KLLVTANNASHMREVQN----TYEDIYREYGSKGDEYAKCLEKRIRITWTLLIGFML--VYIILL 147
            .||       |..::|.    .|.:||.:...:.:.:.|       :...::|..::  :|..::
  Fly    98 ILL-------HFEKLQKFLEIFYANIYIDPRKEPEMFRK-------VDGKMIINRLVSAMYGAVI 148

  Fly   148 GLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGH----LILTAAHV-ILITFGGFG--NYGGD 205
            .|.:..|:| .:|...|..:...:.||   .:|..:    |:||...| |:|....||  |...:
  Fly   149 SLYLIAPVF-SIINQSKDFLYSMIFPF---DSDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCE 209

  Fly   206 MYLFLFVTHVPLIKDIFCVKLTEFNELVMKRNDFP----KVRAMLCDLLVWHQLYTRMLQTTKKI 266
            :.:.|..:::.|.:|     |....|.::...|.|    :::.::...|..:....:..|..:..
  Fly   210 LIVHLNGSYMLLKRD-----LQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQ 269

  Fly   267 YSIVLFVQLSTTCVGLLCTISCIFMKAW--PAAP-LYLLYAAITLYTFCGLGTLVEN--SNEDFL 326
            |::.:|:..: ...||||.:|   .||:  |.|. :|.::..........||.:..:  ...|.|
  Fly   270 YTVRVFIMFA-FAAGLLCALS---FKAYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSL 330

  Fly   327 SVIYTNCLW-----YELPVKEE----KLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSF 382
            |.:|....|     |.....|.    |||.:.:........:|......:|:...|::.:..:|:
  Fly   331 STMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSY 395

  Fly   383 SMML 386
            ...|
  Fly   396 FTFL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 69/343 (20%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 70/345 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.