DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or33c

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:404 Identity:81/404 - (20%)
Similarity:147/404 - (36%) Gaps:78/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FRMWWLTYAVMAAIAFFFACTGYTIYVG-----VVINGDLTIILQALAMVGSA------VQGLTK 89
            :|.:|:...::....|..:.....:||.     |.:...|.::|..|.:..:|      ...||.
  Fly    10 YRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTC 74

  Fly    90 LLVTANNASHMR------EVQNTYEDIYREYGSKGD-----EYAKCLEKRIRITWTLLIGFMLVY 143
            :..:..:.:|:.      |:::..|.:.....|:.:     ::..|..:  |.|..|.|.|.::|
  Fly    75 VACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCHAR--RFTRCLYISFGMIY 137

  Fly   144 IILLGLVITFPIFYLLILHQKVLVMQFLIPF-LDHTTDGGHLILTAAHVILITFGGFGNYGGDMY 207
            .:.|     |.:|..:|.....|:.....|| |:.....|.:.| ...|..:...||...|.|.|
  Fly   138 ALFL-----FGVFVQVISGNWELLYPAYFPFDLESNRFLGAVAL-GYQVFSMLVEGFQGLGNDTY 196

  Fly   208 ----LFLFVTHVPLIKDIFCVKLTEF----NELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTK 264
                |.|...||.|    :.:::.:.    :|.|:...       .|.|.:..|:|..|......
  Fly   197 TPLTLCLLAGHVHL----WSIRMGQLGYFDDETVVNHQ-------RLLDYIEQHKLLVRFHNLVS 250

  Fly   265 KIYSIVLFVQLSTTCVGLLC------------TISCIFMKAWPAAPLYLLY---AAITLYTFCGL 314
            :..|.|..|||. .|...||            |||.::         ||::   ..:.|:..|..
  Fly   251 RTISEVQLVQLG-GCGATLCIIVSYMLFFVGDTISLVY---------YLVFFGVVCVQLFPSCYF 305

  Fly   315 GTLVENSNEDFLSVIYTNCLWYE--LPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTK 377
            .:.|....|.....|::: .||:  ...:.:.||...|.......::.|..:..|::|......|
  Fly   306 ASEVAEELERLPYAIFSS-RWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLK 369

  Fly   378 GIYSFSMMLMNYLG 391
            ..||...:::...|
  Fly   370 MAYSLFAVVVRAKG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 72/353 (20%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 69/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.