DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or30a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:436 Identity:80/436 - (18%)
Similarity:150/436 - (34%) Gaps:105/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKMAKVEPVER--YCKVIRMIRFCVGFCGNDVADPNFRMW-------WLTYAVMAAIAFFFACTG 57
            :::..::|||.  :...:::::|                |       |..|..|... ....||.
  Fly     1 MELKSMDPVEMPIFGSTLKLMKF----------------WSYLFVHNWRRYVAMTPY-IIINCTQ 48

  Fly    58 YT-IYVGVVINGDLTIILQ----ALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYREYGSK 117
            |. ||:.   ...|..|::    |:....:.|:|   :|:.....|:.|.: |..:..|.|....
  Fly    49 YVDIYLS---TESLDFIIRNVYLAVLFTNTVVRG---VLLCVQRFSYERFI-NILKSFYIELLQS 106

  Fly   118 GDEYAKCLEKRIRITWTLL--IGFMLVYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTD 180
            .|.....|.|.......|:  |..::.....:|.| |:|||.    .::||.....:|.:|..  
  Fly   107 DDPIINILVKETTRLSVLISRINLLMGCCTCIGFV-TYPIFG----SERVLPYGMYLPTIDEY-- 164

  Fly   181 GGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAM 245
                                .|....|...||... ::..:.|.....:..:|:   .|.....:
  Fly   165 --------------------KYASPYYEIFFVIQA-IMAPMGCCMYIPYTNMVV---TFTLFAIL 205

  Fly   246 LCDLLVWHQLYTRMLQTTKK-------IYSIVLFVQLS-----------------TTCVG-LLCT 285
            :|.:| .|:|  |.|:..|.       |:.|...::||                 ..|.| :||.
  Fly   206 MCRVL-QHKL--RSLEKLKNEQVRGEIIWCIKYQLKLSGFVDSMNALNTHLHLVEFLCFGAMLCV 267

  Fly   286 ISCIFMKAWPAAPLYLLYAAITLYTFCGLGTLVENSNEDF-----LSVIYTNCLWYELPVKEEKL 345
            :....:.|...|...::.|.:.: .|.....|...:||.:     :::......|.:..|..:|.
  Fly   268 LLFSLIIAQTIAQTVIVIAYMVM-IFANSVVLYYVANELYFQSFDIAIAAYESNWMDFDVDTQKT 331

  Fly   346 IIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMMLMNYLG 391
            :..::.::|..:.:......|:::.....|...||||..:|....|
  Fly   332 LKFLIMRSQKPLAILVGGTYPMNLKMLQSLLNAIYSFFTLLRRVYG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 61/346 (18%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 61/346 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.