DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or23a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:405 Identity:75/405 - (18%)
Similarity:160/405 - (39%) Gaps:54/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKMAKVEPVERYCKVIRMIRFCVGFCGNDVADPNFRMWWLTYAVMAAIAFFFACTGYTIYVGVVI 66
            :|:::...::.:...:...|.|...   |:::..:..|.:...::..:.......|...:...|.
  Fly     1 MKLSETLKIDYFRVQLNAWRICGAL---DLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDPVE 62

  Fly    67 NGDLTIILQALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDI-YREYG-SKGDEYAKCLEKRI 129
            |.      .:|::..:::..|.|..:.....:.|.|||:....: .|..| |:.:.:....|..:
  Fly    63 NN------FSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHLL 121

  Fly   130 RITWTLLIGFMLVYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILI 194
            |::....|.:.:|:||     ...|..:...|.   |.|....||     |..:.::  |::..:
  Fly   122 RMSKLFQITYAVVFII-----AAVPFVFETELS---LPMPMWFPF-----DWKNSMV--AYIGAL 171

  Fly   195 TFGGFGNYGGDMYLFLFVTHVPLIK-------DIFCVKLTE--FNELVMKRNDFPKVRAMLCDLL 250
            .|...|.....|..|...:..||:.       .:..::::|  :....::.|:...|..:...  
  Fly   172 VFQEIGYVFQIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENEQDLVNCIRDQ-- 234

  Fly   251 VWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLCTISCIFMKAWPAAPLY--------LLYAAIT 307
              :.|| |:|..||.:.|..:.||.....:.:..|   :|:..:....||        ||...:.
  Fly   235 --NALY-RLLDVTKSLVSYPMMVQFMVIGINIAIT---LFVLIFYVETLYDRIYYLCFLLGITVQ 293

  Fly   308 LYTFCGLGTLVENS-NEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNT 371
            .|..|..||:|:.| .|...:|..:|  |.:........::::..:.:...:|.|.::.|:.::|
  Fly   294 TYPLCYYGTMVQESFAELHYAVFCSN--WVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLST 356

  Fly   372 ALQLTKGIYSFSMML 386
            .:...||.|||..::
  Fly   357 YVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 64/330 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 66/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.