DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or22b

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:375 Identity:65/375 - (17%)
Similarity:146/375 - (38%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PNFRMWWLTYAVMAAIAFFFACTGYTIYVGVVINGDLTIILQALAMVGSAVQGLTKLLVTANNAS 98
            |..:.|.|.|.:.:..                    :|:::..|..:..:|:.:.: ..|.:...
  Fly    39 PENKRWDLHYKLWSTF--------------------VTLLIFILLPISVSVEYIQR-FKTFSAGE 82

  Fly    99 HMREVQ---NTYEDIYREY----GSKGDEYAK-----------CLEKRIRITWTLLIG---FMLV 142
            .:..:|   |.|...::.|    |.|..:.||           |.|:|..:...:.:|   ::..
  Fly    83 FLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHVALGNFCYIFY 147

  Fly   143 YIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMY 207
            :|.....:|:   .:|..:.:::...:...|::|  .:....|.:.|.|||..:..|.:...|:.
  Fly   148 HIAYTSFLIS---NFLSFIMKRIHAWRMYFPYVD--PEKQFYISSIAEVILRGWAVFMDLCTDVC 207

  Fly   208 LFLFVT----HVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYS 268
            ..:.:.    |:.|:|.    :|........:..|  :....|.|.:..|:|....:...:.::|
  Fly   208 PLISMVIARCHITLLKQ----RLRNLRSEPGRTED--EYLKELADCVRDHRLILDYVDALRSVFS 266

  Fly   269 IVLFVQLSTTCVGLLCTISCI------FMKAWPAAPLYLLYAAITLYTFCGLGTLVENSNEDFLS 327
            ..:|||.  ..:|::..:|.|      .:....|..|::...::..:.||.|..::.:..::...
  Fly   267 GTIFVQF--LLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMAD 329

  Fly   328 VIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTK 377
            .::.:. |.....:.:..::..|...|..::|||..:.|:||.|.|.:.|
  Fly   330 SLFQSD-WTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 61/340 (18%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 57/312 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D56928at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.