DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or9a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:427 Identity:84/427 - (19%)
Similarity:161/427 - (37%) Gaps:80/427 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKMAKVEPVERYCKVIRMIRFCVGFCGNDVADP---NFRMWWLTYAVMA-----AIAFFFACTGY 58
            :|..|.|..::..:|..::..|:|.   |:..|   |.|. |||:..|.     .:..|.|...|
  Fly     5 VKGKKQEEKDQSLRVQILVYRCMGI---DLWSPTMANDRP-WLTFVTMGPLFLFMVPMFLAAHEY 65

  Fly    59 TIYVGVVINGDLTIILQALAMVGSAVQGLTKLLVTANNAS-------HMREVQNTYEDIY---RE 113
            ...|        :::...|....:::..|.|.|:...:..       |:|.:.....:::   ||
  Fly    66 ITQV--------SLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDARE 122

  Fly   114 YGSKGDEYAKCLEKRIRITWTLLIGFMLVYIIL---LGLVITF---PIFYLLILHQKVL-----V 167
            .    .|.....::.:.:|:|...|...::..|   :|::::.   ...:|.:.|..|.     |
  Fly   123 I----IEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQV 183

  Fly   168 MQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFCVKLTEFNEL 232
            :.|.:|.........:..:|.|..:            |..||.|..:|..|     .|:.:...:
  Fly   184 VMFYVPTYLWNVMASYSAVTMALCV------------DSLLFFFTYNVCAI-----FKIAKHRMI 231

  Fly   233 VMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLCTISCIFMKAWP-A 296
            .:......:....|..:|:.||...::.......|..::|:|...:.: .:|.|.......:| .
  Fly   232 HLPAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSAL-QICFIGFQVADLFPNP 295

  Fly   297 APLYL------LYAAITLYTFCGLGTLVENSNEDFLSVIY-TNCLWYELPVKEEKLIIMMLAK-- 352
            ..||.      |..|:.:|:.||..  :::::.||.:.:| ||...:..|.|...||..|.|:  
  Fly   296 QSLYFIAFVGSLLIALFIYSKCGEN--IKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRP 358

  Fly   353 AQNEVVLTAADMAPLSMNTALQLTKGIYSFSMMLMNY 389
            .|.:.....|.||..|     .:.:...|:.|||.::
  Fly   359 CQMKGYFFEASMATFS-----TIVRSAVSYIMMLRSF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 62/341 (18%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 63/349 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.