DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or65c

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:418 Identity:75/418 - (17%)
Similarity:151/418 - (36%) Gaps:128/418 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FRMWWLTYAVM-AAIAFFFACTGYTIYVG--VVINGDLTIILQALAMVGSAVQGLTKLLVTANNA 97
            :|..|.|..:: |.:.|...|.|.|..:|  |.:..|:..|:....:                  
  Fly    56 YRSSWHTLVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGFFYI------------------ 102

  Fly    98 SHMREVQNTYEDIYRE-YGSKGDEYAKCLEK--------------RIRITWTLLIGFML------ 141
                    .::..|.: ||.:.||..:.||.              |....|...:.|.|      
  Fly   103 --------AFKIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRTAKRWYFTLAFFLASSWLV 159

  Fly   142 ---VYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYG 203
               ::|:||   ||.|::    :||::|.:....||..|.        .:.|.|...|       
  Fly   160 FLCIFILLL---ITSPLW----VHQQILPLHAAFPFQWHE--------KSIHPISHAF------- 202

  Fly   204 GDMYLF------LFVTHVPLIK--------------DIFCVKLTEFNELVMKRNDFPKVRAMLCD 248
              :|||      .|:|.:..|:              ::.|::|...::   :.:.:.::|.....
  Fly   203 --IYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAIEVLCLELRHLHQ---RCHGYEQLRLETNR 262

  Fly   249 LLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLCTISCIFMKAWPA----------APLYLL- 302
            |:.:||....:|..|.|::...|.:|:...    ...:|...::|..|          |.|.|| 
  Fly   263 LVQFHQKIVHILDHTNKVFHGTLIMQMGVN----FFLVSLSVLEAMEARKDPKVVAQFAVLMLLA 323

  Fly   303 YAAITLYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLI----IMMLAKAQNEVVLTAAD 363
            ...::::::  .|.|:...:.......|..   |: |:|..|.:    .:::.:.|..:::.|:.
  Fly   324 LGHLSMWSY--FGDLLSQKSLTISEAAYEA---YD-PIKGSKDVYRDLCLIIRRGQEPLIMRASP 382

  Fly   364 MAP---LSMNTALQLTKGIYSFSMMLMN 388
            ...   ::.:..|....||.:|.:..::
  Fly   383 FPSFNFINYSAILNQCYGILTFLLKTLD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 63/372 (17%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 63/374 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.