DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or69a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:376 Identity:73/376 - (19%)
Similarity:142/376 - (37%) Gaps:60/376 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MWWLTYAVMAAIAFFFACTGYTIYVGVVING---DLTIILQALA----MVGSAVQGLTKLLVTAN 95
            ::||     .|:...:...|..:| |...:|   |....|..||    |:|..:.|...|....:
  Fly    41 IFWL-----GAVNLVYHNIGCVMY-GYFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLS 99

  Fly    96 NASHMREVQNTYEDIY-----REYGSKGDEYAKCLEKRIRITWTLLIGFMLVYIILLGLVITFPI 155
            ..:|...:.|.:|:::     |.|  :...|.:...:.||.|:......::.|..|       ||
  Fly   100 LKTHFENLLNEFEELFQLIKHRAY--RIHHYQEKYTRHIRNTFIFHTSAVVYYNSL-------PI 155

  Fly   156 FYLLILHQKVLVMQFL---------IPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLF 211
              ||::.:.....|.|         .|:....:..|.....|..:    |....|...:|::...
  Fly   156 --LLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQI----FSCQTNMCVNMFIQFL 214

  Fly   212 VTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLS 276
            :....:..:|....|....|.:..||  |..:..|..|:|:|.....:.....:.::....:.||
  Fly   215 INFFGIQLEIHFDGLARQLETIDARN--PHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLS 277

  Fly   277 TTCVG--LLCTISCIF-----MKAWPAAPLYLLYAAITLYTFCGLGT-LVENSNEDFLSVIYTNC 333
            .:.:.  .|.....:|     :|......|::.|.    ::.|..|| |:..|.:...:..|.| 
  Fly   278 VSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYN----FSMCRSGTHLILTSGKVLPAAFYNN- 337

  Fly   334 LWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSM 384
             |||..:...:::::::.:|....:.....:||:|:.|.:...|  :|:.|
  Fly   338 -WYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLK--FSYQM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 64/336 (19%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 63/333 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.