DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67d and Or46a

DIOPT Version :9

Sequence 1:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster


Alignment Length:296 Identity:55/296 - (18%)
Similarity:100/296 - (33%) Gaps:84/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TW---------TLLIGFMLVYIILLGLVITF-------------PIFYLL---------ILHQKV 165
            ||         ::..||:||.:.::.|:.:|             .:|::.         :||.|:
  Fly    24 TWAADHQRRFQSMRFGFILVILFIMLLLFSFEMLNNISQVREILKVFFMFATEISCMAKLLHLKL 88

  Fly   166 -------LVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYG----GDMYLFLFVTHVPLIK 219
                   ||...|.|.....::....:|....|.::...  .:||    |...|.|.|.      
  Fly    89 KSRKLAGLVDAMLSPEFGVKSEQEMQMLELDRVAVVRMR--NSYGIMSLGAASLILIVP------ 145

  Fly   220 DIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLC 284
               |  ...|.||.:...:...:...:|   .|.|.   :..:...:.:.||.:...:....|||
  Fly   146 ---C--FDNFGELPLAMLEVCSIEGWIC---YWSQY---LFHSICLLPTCVLNITYDSVAYSLLC 199

  Fly   285 TISCIFMKAWPAAPLYLLYAAITLYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMM 349
                 |:|    ..|.:|...:.     .||.::|..:.:.:::....|..|...:...|.::.:
  Fly   200 -----FLK----VQLQMLVLRLE-----KLGPVIEPQDNEKIAMELRECAAYYNRIVRFKDLVEL 250

  Fly   350 LAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMM 385
            ..|....|.|         |.:.|.|...:|..|.|
  Fly   251 FIKGPGSVQL---------MCSVLVLVSNLYDMSTM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 52/289 (18%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 47/258 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.