DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or98b

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:236 Identity:54/236 - (22%)
Similarity:106/236 - (44%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FGFLIWFPFDATR--NNLIYWIMYWDIAHGAYLAGIAF--LCADLLLVVVITQICMHF---NYIS 235
            |.|...:|:|..:  |.:|.:  :|::...   .|:|.  :|.|.|...:...:|..|   .:..
  Fly   161 FPFPSVYPWDNMKLSNYIISY--FWNVCAA---LGVALPTVCVDTLFCSLSHNLCALFQIARHKM 220

  Fly   236 MRLEDHPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTE 300
            |..|..  |:.|..||::.   :.:.:..||.|...:|: |...|:..|:.||:.:|.:.:|::.
  Fly   221 MHFEGR--NTKETHENLKH---VFQLYALCLNLGHFLNE-YFRPLICQFVAASLHLCVLCYQLSA 279

  Fly   301 STVE-VIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKW---FQCSKSYCTMLKLLI 361
            :.:: .::.|..|....:.||.:.|:.|.::.:.....|.|.|...|   .|.:....:.||:.:
  Fly   280 NILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAM 344

  Fly   362 MRSQKPASIRPPT---FPPISLVTYMKVISMSYQFFALLRT 399
            |||    |:..|.   |...:..|.:.::..:..:..|||:
  Fly   345 MRS----SLGCPIDGYFFEANRETLITIVRTAISYVTLLRS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 51/226 (23%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 51/225 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.