DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or98a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:428 Identity:78/428 - (18%)
Similarity:150/428 - (35%) Gaps:125/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RSTNPLKSLL----FKIYLYAGF-INFNLLVIGELVFFYNSIQDFETIRLAIAVAPCIGFSLVAD 93
            |..||...|.    |:.:.|..| :.::.....:::::..|               |:.|:..|.
  Fly     7 RKPNPTNLLTSPDSFRYFEYGMFCMGWHTPATHKIIYYITS---------------CLIFAWCAV 56

  Fly    94 FKQAAMIRGKKTLIMLLDDLENMHPKTLAKQME----------------------YK----LPDF 132
            :....:|...||      |:....|..|...|:                      ||    |.:.
  Fly    57 YLPIGIIISFKT------DINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEM 115

  Fly   133 EK---TMKRVIN-------------IFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFL 181
            :|   |:|..:.             |:.|:..|||.:.....|:...:.:..  |:.|       
  Fly   116 DKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKLPWRI--YNPF------- 171

  Fly   182 IWFPFDATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICM--------------HFN 232
              ..|..:|::      :|..|          |....|::..:||..|              |..
  Fly   172 --VDFRESRSS------FWKAA----------LNETALMLFAVTQTLMSDIYPLLYGLILRVHLK 218

  Fly   233 YISMRLEDHPCNSNE-DKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAF 296
            .:.:|:|....:|.: |.||.:.||..|:.|:..:.....:....:.::.:.||:  :.||    
  Fly   219 LLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLL--IGIC---- 277

  Fly   297 QVTESTVEVIIIYCI--------FLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSY 353
             :..|.:.::....|        ::...|||.|..|:..|.|......:..|.::..|...|:||
  Fly   278 -LGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSY 341

  Fly   354 CTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSY 391
            .:.|:..:..:||..:....:..|||..:.:||..:::
  Fly   342 KSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAF 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 69/369 (19%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 63/338 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.