DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or85e

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:471 Identity:93/471 - (19%)
Similarity:165/471 - (35%) Gaps:110/471 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQFYRTIGEDIYAHRSTNPLK-SLLFKIYLYAGFIN-------------FNLLVIGE-LVFFYNS 69
            :||:..:..||....|.:|.: |.||::.:.....|             ..|.:||: |...|.|
  Fly     4 LQFHGNVDADIRYDISLDPARESNLFRLLMGLQLANGTKPSPRLPKWWPKRLEMIGKVLPKAYCS 68

  Fly    70 IQDFETIRLAIA-------VAPCIGFSLVADFKQAAMI---RGKKTLIMLLDDLENMHPKTLAKQ 124
            :..|.::.|.:.       |.|......:.|.....:|   .|..|:...|      ..:.|...
  Fly    69 MVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIYWCL------RSRRLLAY 127

  Fly   125 MEYKLPDFEKTMKRVINIFTFLCLAYTTTFSFYPAIKASVKFN-------FLGYDTFD------- 175
            ||:        |.|.   :....||..|..|.:.|.:.|..|.       .||..::.       
  Fly   128 MEH--------MNRE---YRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLG 181

  Fly   176 -RNFGFLIWFPFDATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMHFN--YISMR 237
             |......|:||||.... .|..:|.....|..:.|:.|.....|.|.:...:...|:  |.|::
  Fly   182 IRMLPLQCWYPFDALGPG-TYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLK 245

  Fly   238 --------------------------------------LEDHPCN--------SNEDKENI--EF 254
                                                  |::||.:        ...|:.|.  ..
  Fly   246 NLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNA 310

  Fly   255 LIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEV--IIIYCIFLMTSM 317
            |:..||.|...|...:.:.:|:|...|:..|..:.|:|.:.|.....|.||  |:....:|..::
  Fly   311 LVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTI 375

  Fly   318 VQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVT 382
            .::.|..|.|:.|...|::.|||.:...|::.:......:.:.::.|::...:....|..:.:..
  Fly   376 FELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNR 440

  Fly   383 YMKVISMSYQFFALLR 398
            ...||:.::.|..||:
  Fly   441 LRSVITQAFSFLTLLQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 70/374 (19%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 65/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.