DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or83c

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:436 Identity:85/436 - (19%)
Similarity:164/436 - (37%) Gaps:94/436 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METAKDNTARTFMELMRVPVQFYRTIGEDIYAHRSTNPLK------SLLFKIYLYAGFINFNLLV 59
            |.|::..::| |.||.:........:|.|..:.:    ||      :.:|.|..|.||..|.:| 
  Fly     1 MSTSESPSSR-FRELSKYINSLTNLLGVDFLSPK----LKFNYRTWTTIFAIANYTGFTVFTIL- 59

  Fly    60 IGELVFFYNSIQDFETIRLAIAVAPCIGFSLVADFKQAAMIRG-KKTLIMLL--DDLEN--MHPK 119
                    |:..|:..             .|.|......:..| .|.|..||  .|:..  ::.:
  Fly    60 --------NNGGDWRV-------------GLKASLMTGGLFHGLGKFLTCLLKHQDMRRLVLYSQ 103

  Fly   120 TLAKQMEYKLPDFEKTMK----RVINIFTFLCLAYTTTFSFYPAIKASVKFNFLGYD-TFDRNFG 179
            ::..:.|.:...:.:|:.    |::.|...:...|...|.....:..::    |.|| |......
  Fly   104 SIYDEYETRGDSYHRTLNSNIDRLLGIMKIIRNGYVFAFCLMELLPLAM----LMYDGTRVTAMQ 164

  Fly   180 FLIWFPFDATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLED---- 240
            :||  |.....||..|.:.|........:.|:.|...||.:.:.:|||....:.:.:::::    
  Fly   165 YLI--PGLPLENNYCYVVTYMIQTVTMLVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKELNDA 227

  Fly   241 --------------HPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQI 291
                          ...:..|:::.:  |:.:||:|......|..:|.|| :.|           
  Fly   228 LEQKAEYRALVRVGASIDGAENRQRL--LLDVIRWHQLFTDYCRAINALY-YEL----------- 278

  Fly   292 CFIAFQVTESTVEVIIIYC-----------IFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQK 345
              ||.||....:.:::.:|           ||.:.|...:.:.|..|..|..|..:|.::..|..
  Fly   279 --IATQVLSMALAMMLSFCINLSSFHMPSAIFFVVSAYSMSIYCILGTILEFAYDQVYESICNVT 341

  Fly   346 WFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSY 391
            |::.|.....:...|:..||.|.:|:......:|:.|.::::.:.|
  Fly   342 WYELSGEQRKLFGFLLRESQYPHNIQILGVMSLSVRTALQIVKLIY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 65/343 (19%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 65/339 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.