DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Orco

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:163 Identity:43/163 - (26%)
Similarity:82/163 - (50%) Gaps:11/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NSNEDKENIEFLI-GIIRY----HDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTV 303
            |.|...:..|.:: ..|:|    |...::|...:.|.|..:|||:.|.:::::..:|:|.|:  :
  Fly   322 NPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATK--I 384

  Fly   304 EVIIIYCI----FLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRS 364
            ..:.:|..    :|..::.|||..|.:|:.||..|..|.:|||:..|:..|:...|.::::..:.
  Fly   385 NGVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQC 449

  Fly   365 QKPASIRPPTFPPISLVTYMKVISMSYQFFALL 397
            ||..||....|..:||..:..|:.....:|.:|
  Fly   450 QKAMSISGAKFFTVSLDLFASVLGAVVTYFMVL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 41/155 (26%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.