DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or59b

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:403 Identity:81/403 - (20%)
Similarity:149/403 - (36%) Gaps:68/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DIYAHRS------TNPLKSLLFKIYLYAGFINFNL----LVIGELVFFYNSIQDFETIRLAIAVA 83
            :||.:|:      ..|.:.:|..:||:...:.|..    |.:|.::.:....::|.......::.
  Fly    22 NIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYVQEFKNFTPGEFLTSLQ 86

  Fly    84 PCI---GFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVIN---- 141
            .||   |.|:.:......:.|.:||.| |||.|:    |.||..     .|.|:....|..    
  Fly    87 VCINVYGASVKSTITYLFLWRLRKTEI-LLDSLD----KRLAND-----SDRERIHNMVARCNYA 141

  Fly   142 --IFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFDATRNNL-IYWIMYWDIA 203
              |::|:...|..:             .||.|....|. .:.::.||...|:.: ..||.    |
  Fly   142 FLIYSFIYCGYAGS-------------TFLSYALSGRP-PWSVYNPFIDWRDGMGSLWIQ----A 188

  Fly   204 HGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKE-----NIEFLIGIIRYHD 263
            ...|:.....:..|.|.........:.|......|:||..:...|.|     |.:.|:..:..|.
  Fly   189 IFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHK 253

  Fly   264 KCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI--------IIYCIFLMTSMVQV 320
            ..||.|:.:..:.|.::.:.|.:       |...:..:.|.|.        :...:|::|.::|.
  Fly   254 TILKCCDMIRPMISRTIFVQFAL-------IGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQT 311

  Fly   321 FMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMK 385
            |..||..:.||..:..:.:..:...|......|...|.|.:...|:|.........|||:.:.:.
  Fly   312 FPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNIT 376

  Fly   386 VISMSYQFFALLR 398
            |...::....::|
  Fly   377 VAKFAFSIITIVR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 68/327 (21%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 69/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.