DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or59a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:399 Identity:87/399 - (21%)
Similarity:164/399 - (41%) Gaps:67/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YRTIGEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLV-------IGELVFFYNSIQDFETIRLAI 80
            :|.:|   .||......|:|    |::...:: ||||       :|..:|...:|.  |.|....
  Fly    19 WRYLG---VAHFRVENWKNL----YVFYSIVS-NLLVTLCYPVHLGISLFRNRTIT--EDILNLT 73

  Fly    81 AVAPCIGFS---LVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVINI 142
            ..|.|...|   |:..:....::..::.|.:|.:.:.....:::..|:..:|       :.|:.:
  Fly    74 TFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQL-------RNVLYV 131

  Fly   143 FTFLCLAYTTTFSFYP-AIKASVKFNFLGYDTFDRNFGFLIWFPFD---ATRNNLIYWIMYWDIA 203
            |..:         :.| |:.|.:.|.|    ..:|...:..|||||   :|||       |: ||
  Fly   132 FIGI---------YMPCALFAELSFLF----KEERGLMYPAWFPFDWLHSTRN-------YY-IA 175

  Fly   204 HGAYLAGIAF-----LCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHD 263
            :...:.||:|     ..:|....||:..|..|...:..|.|:...:...|.|  :.|...|..|.
  Fly   176 NAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPARDAE--KDLEACITDHK 238

  Fly   264 KCLKLCEHVNDLYSFSLLLNFLMASMQICF----IAFQVTESTVEVIIIYCIFLMTSM-VQVFMV 323
            ..|:|...:....|..:|:.|.:.::.:|.    :.|.|:|....   :|.||...:| :|:|..
  Fly   239 HILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSEPMAR---MYFIFYSLAMPLQIFPS 300

  Fly   324 CYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVIS 388
            |::|........::..||::..|...::|:...:.|.:.:|.|.::........|.|.|:...:.
  Fly   301 CFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLK 365

  Fly   389 MSYQFFALL 397
            .:|..|.::
  Fly   366 GAYSLFTII 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 67/321 (21%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 72/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.