DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or56a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:407 Identity:68/407 - (16%)
Similarity:168/407 - (41%) Gaps:72/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLKSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFETIRLAIAVAPCIGFSLVADFKQAAMIRG 102
            ||.||:....|.|.......|::..:...|.::.|..|     :.|..:.:..|:.....|.::.
  Fly    40 PLLSLIRCTILTASIWLSCALMLARVFRGYENLNDGAT-----SYATAVQYFAVSIAMFNAYVQR 99

  Fly   103 KKTLIMLL---DDLENMHPKTLAKQMEYKLPD--FEKTMKRVINIFTFLC--LAYT--------- 151
            .|.:.:|.   .|::|:..:...::||..:..  :.:|:..:|.|.:.:.  :||:         
  Fly   100 DKVISLLRVAHSDIQNLMHEADNREMELLVATQAYTRTITLLIWIPSVIAGLMAYSDCIYRSLFL 164

  Fly   152 --TTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFDATRNNLIY-WIMYWDIAHGAYLAGIAF 213
              :.|: .||::...:...|.:..          |||....:|.:. ::..|      |..|:..
  Fly   165 PKSVFN-VPAVRRGEEHPILLFQL----------FPFGELCDNFVVGYLGPW------YALGLGI 212

  Fly   214 LCADL---LLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIG-----------------I 258
            ....|   .:..::..:.:....::.|:|:    .:..:.|.:.:||                 .
  Fly   213 TAIPLWHTFITCLMKYVNLKLQILNKRVEE----MDITRLNSKLVIGRLTASELTFWQMQLFKEF 273

  Fly   259 IRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVT---ESTVEVIIIYC-IFLMTSMVQ 319
            ::...:..|..:.:..|....::.:|::.|:.|||:.|.:|   .|.::...::. :|:|..::.
  Fly   274 VKEQLRIRKFVQELQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILW 338

  Fly   320 VFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYM 384
            ::.  ::...::....::..|.::..|:........||..::|.:|:|..:| .....::|.|::
  Fly   339 IYH--WHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMR-ALLVDLNLRTFI 400

  Fly   385 KVISMSYQFFALLRTTY 401
            .:...:|.:|.|||:::
  Fly   401 DIGRGAYSYFNLLRSSH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 52/347 (15%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 45/304 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.