DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or45b

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:380 Identity:82/380 - (21%)
Similarity:153/380 - (40%) Gaps:40/380 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFETIRLAIAVAPCIGFSLVADFKQAAMIRGKK 104
            :|.|..::|...|:|.......|.||.::.::. ..:....|..| :..|....||...|...::
  Fly    35 QSWLHLLWLVFNFVNLAHCCQAEFVFGWSHLRT-SPVDAMDAFCP-LACSFTTLFKLGWMWWRRQ 97

  Fly   105 TLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVINIFTFLC--LAYT----TTFSF------- 156
            .:..|:|.:     :.|..:.|.:.....|..:|...:....|  |.:|    ||.:|       
  Fly    98 EVADLMDRI-----RLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTLGSITTGAFVLRSLWE 157

  Fly   157 -----YPAIKASVKFNFLGYDTFDRNFGFLIWFPFDATRNNLIYWIMYW--DIAHGAYLAGIAFL 214
                 :...|..:.|..|.:|...|    :.|||       :.|....|  .:...|:.....|.
  Fly   158 MWVRRHQEFKFDMPFRMLFHDFAHR----MPWFP-------VFYLYSTWSGQVTVYAFAGTDGFF 211

  Fly   215 CADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFS 279
            ....|.:..:.|...:....:::....| :..|.|...:.|..|:..|::..|:.:..:.:.:..
  Fly   212 FGFTLYMAFLLQALRYDIQDALKPIRDP-SLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAP 275

  Fly   280 LLLNFLMASMQICFIAFQVTESTVEVIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQ 344
            ..::|:.||:.|......:...:...||.|.::..|....:|:.||.|..:...||.:|:|||:.
  Fly   276 TFVHFVSASLVIATSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSS 340

  Fly   345 KWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFALLRT 399
            .|:...:.....:.|:|:|:|:|.::|.|.|.| ||..:..||..:....||.:|
  Fly   341 AWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 69/324 (21%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 71/336 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.