DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or43a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:419 Identity:86/419 - (20%)
Similarity:152/419 - (36%) Gaps:118/419 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TFMELMRVPVQFYRTIGEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLV---------------I 60
            |.|.||    ||       :|..|....|.:.:..::.::..  ||.|:               :
  Fly    40 TAMNLM----QF-------VYLLRMWGDLPAFILNMFFFSAI--FNALMRTWLVIIKRRQFEEFL 91

  Fly    61 GELVFFYNSIQDF--------------ETIRLAIAVAPCIGFSLVADFKQAAMIRGKKTLIMLLD 111
            |:|...::||.|.              |...|||       .:|.|.|..   |.|  .|:..|.
  Fly    92 GQLATLFHSILDSTDEWGRGILRRAEREARNLAI-------LNLSASFLD---IVG--ALVSPLF 144

  Fly   112 DLENMHPKTLAKQMEYKLPDFEKTMKRVINIFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDR 176
            ..|..||..||      ||....|...|..:   :.||...|    |.:.:              
  Fly   145 REERAHPFGLA------LPGVSMTSSPVYEV---IYLAQLPT----PLLLS-------------- 182

  Fly   177 NFGFLIWFPFDATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDH 241
                :::.||                  .:..||:|.....:|      ||.:|      ||...
  Fly   183 ----MMYMPF------------------VSLFAGLAIFGKAML------QILVH------RLGQI 213

  Fly   242 PCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAF--QVTESTVE 304
            ......::|..:.|...|.||.:.::....:|.|.:..:.:..::....||.:.|  .:..|..:
  Fly   214 GGEEQSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQ 278

  Fly   305 VIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPAS 369
            ||.| .::::|.:..:|......:.:...:.:|.:|.||..|::....:...|.:.:|::|.|..
  Fly   279 VISI-VMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPME 342

  Fly   370 IRPPTFPPISLVTYMKVISMSYQFFALLR 398
            ||.....|::|..:..:::.||.:|.:||
  Fly   343 IRVGNVYPMTLAMFQSLLNASYSYFTMLR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 60/306 (20%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 73/383 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.