DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or35a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:351 Identity:69/351 - (19%)
Similarity:135/351 - (38%) Gaps:63/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 AMIRGKKTLIMLLDDLEN-----MHPKTLAKQME------YKLPDFEKTM------KRVINIFTF 145
            |.:.|..|.::|::....     :|.:.|.|.:|      |..|..|..|      |.:||  ..
  Fly    77 AFLTGMPTYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIIN--RL 139

  Fly   146 LCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFDATRNNLIYWIMYWDIAHGAYLAG 210
            :...|....|.|  :.|.| |:.:..   .::|.:.:.||||:....:...::..::..|..:..
  Fly   140 VSAMYGAVISLY--LIAPV-FSIINQ---SKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVIDT 198

  Fly   211 IAFLCADLLLVVVITQICMHFNYISMRLE--------------DHPCNSNEDKENIEFLIGIIRY 261
            :.|...:||..:::     |.|...|.|:              |.|..:.:.|   ..:...:|.
  Fly   199 MMFGETNLLCELIV-----HLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLK---VLITKTLRK 255

  Fly   262 HDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVIIIYCIFLMTSMVQVFMVCYY 326
            :....:..:.:...|:..:.:.|..|:..:|.::|:...:.: ...||.|:.....|::..:...
  Fly   256 NVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPM-ANYIYAIWFGAKTVELLSLGQI 319

  Fly   327 GDTLIAASLKVGDAAYNQKWFQCSKSYCT-------MLKLL---IMRSQKPASIRPPTFPPISLV 381
            |..|...:..:....|...|.|..: |.|       :|||:   |..:.||..:....:..:||.
  Fly   320 GSDLAFTTDSLSTMYYLTHWEQILQ-YSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQ 383

  Fly   382 TYMKVISMSYQFFALL----RTTYSN 403
            ..:|::..|:.:|..|    |...||
  Fly   384 AGLKILQASFSYFTFLTSMQRRQMSN 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 63/333 (19%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 63/333 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.