DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or33c

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:410 Identity:79/410 - (19%)
Similarity:148/410 - (36%) Gaps:77/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TFMELMRVPVQFYRTIGEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFET 75
            ||.:....|||.|..:         .:.|.:|.|.::|.     .:||::.....|:.::    |
  Fly    23 TFFKDSSRPVQLYVVL---------LHILVTLWFPLHLL-----LHLLLLPSTAEFFKNL----T 69

  Fly    76 IRLAIAVAPCIGFSL--VADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKR 138
            :.|.     |:..||  ||.......|...::||..||..       :|.:.|::.      .:.
  Fly    70 MSLT-----CVACSLKHVAHLYHLPQIVEIESLIEQLDTF-------IASEQEHRY------YRD 116

  Fly   139 VINIFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLI-------------WFPFDATR 190
            .::     |.|...|...|      :.|..: |..|  .||..:             :||||...
  Fly   117 HVH-----CHARRFTRCLY------ISFGMI-YALF--LFGVFVQVISGNWELLYPAYFPFDLES 167

  Fly   191 NNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFL 255
            |..:..:..........:.|...|..|....:.:..:..|.:..|:|:.......:|...|.:.|
  Fly   168 NRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRL 232

  Fly   256 IGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIA----FQVTESTVEVIIIYCIFLMTS 316
            :..|..|...::....|:...|...|:........:|.|.    |.|.: |:. ::.|.:|....
  Fly   233 LDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGD-TIS-LVYYLVFFGVV 295

  Fly   317 MVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMR----SQKPASIRPPTFPP 377
            .||:|..||:...:.....::..|.::.:|:..|:.:  ...|||..    ..:...|:......
  Fly   296 CVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDH--RFDLLIFTQLTLGNRGWIIKAGGLIE 358

  Fly   378 ISLVTYMKVISMSYQFFALL 397
            ::|..:...:.|:|..||::
  Fly   359 LNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 60/327 (18%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 64/351 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.