DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or22c

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:403 Identity:78/403 - (19%)
Similarity:156/403 - (38%) Gaps:68/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLVIGEL-------VFFYNSIQDFETIRLAIAVAP 84
            |...:||        |||   ::|    |.::|:|.:       |...|.:...|........|.
  Fly    36 GRPWHAH--------LLF---VFA----FAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKAV 85

  Fly    85 CIGFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVINIFTFLCLA 149
            |:       .|.....|..:....|:..|..:..::..::.:..|.....|..|:..:......|
  Fly    86 CV-------LKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTA 143

  Fly   150 YTTTFSFYPAI------------KASVKFNFLGYDTFDRNFGFLIWFPFDATRNNLIYWIMYWDI 202
            ....|:..|.|            :..:.||.: ..:|....|.   ||       |.|.::   .
  Fly   144 TNAAFTLQPLIMGLYRWIVQLPGQTELPFNII-LPSFAVQPGV---FP-------LTYVLL---T 194

  Fly   203 AHGA-------YLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEF---LIG 257
            |.||       ::.|. |:|:.|.:......:......|...|.....:...::.|.|.   |..
  Fly   195 ASGACTVFAFSFVDGF-FICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQ 258

  Fly   258 IIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI-IIYCIFLMTSMVQVF 321
            ::..|:..:..|..:...::..:|::||.|:..:|.....:..:|..:. :.|..:::.::.|:|
  Fly   259 VVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLF 323

  Fly   322 MVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKV 386
            :.|:.|:.:..:|..|.|..|:.:|::|......::.:::.|||:..:|..|.|.| ||.....:
  Fly   324 LYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTP-SLPALRSI 387

  Fly   387 ISMSYQFFALLRT 399
            :|.:..:..||:|
  Fly   388 LSTAGSYITLLKT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 60/327 (18%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 64/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.