DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or10a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:407 Identity:99/407 - (24%)
Similarity:167/407 - (41%) Gaps:84/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TNPLKSLLFKIYLYAGFINFNLLVIGELVFFYNSI--QDFETIRLAIAVAPCIGFSLVADFKQAA 98
            |.|.:||          |:|.:|.||.....:..:  .|.:.|.||:......|.|.|...|...
  Fly    39 TWPWRSL----------IHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFL 93

  Fly    99 MIRGKKTLIMLLDDLENM-------HPKTLAKQMEYKLPDFEKTMKRVINIFT-----FLCLAYT 151
            |:|.::.|.::.:.|..:       .|    :|.:.:|.  ...|...||.:.     |.|    
  Fly    94 MLRFRQDLSIMWNRLRGLLFDPNWERP----EQRDIRLK--HSAMAARINFWPLSAGFFTC---- 148

  Fly   152 TTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWF-PFDATR-----NNLIYWIMYWDIAHGAYLAG 210
            ||::..|.:.|.:.:....|:.|       :|| ||:.|.     |...:.:.|..||:..|:..
  Fly   149 TTYNLKPILIAMILYLQNRYEDF-------VWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTI 206

  Fly   211 IAF---------LCADL--LLVVVITQICMHFNYISMRLEDHPCNSN--EDKENIEFLIGIIRYH 262
            ..|         .||.|  |..|:..:|...|...:..||..|....  |.|     :..:|..|
  Fly   207 FMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQK-----MRSVIIRH 266

  Fly   263 DKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI---------IIYCIFLMTSMV 318
            :..:.|.....|.|:...|.:|:.|:|.|.|       |.|.::         ::|..:.:.::.
  Fly   267 NAIIDLTRFFRDRYTIITLAHFVSAAMVIGF-------SMVNLLTLGNNGLGAMLYVAYTVAALS 324

  Fly   319 QVFMVCYYGDTLIA-ASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVT 382
            |:.:.| ||.||:| :|..:..|.::..|.........:::|||:|||:|.|:..|.|.| ||.|
  Fly   325 QLLVYC-YGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSP-SLAT 387

  Fly   383 YMKVISMSYQFFALLRT 399
            :..::..|....||:::
  Fly   388 FAAILQTSGSIIALVKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 83/345 (24%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 86/356 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.