DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or65b

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:308 Identity:66/308 - (21%)
Similarity:134/308 - (43%) Gaps:28/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LIMLLDDLENMHP--KTLAKQMEYKLPDFEKTMKRVINIFTFLCLAYTTTFSFYPAIKASVKFNF 168
            |..::.||:.:||  :.....:||      :|.||...:..|.   ..|::||:..|...:....
  Fly   112 LDQVISDLDALHPWAQKGPNPVEY------QTGKRWYFVMAFF---LATSWSFFLCILLLLLITS 167

  Fly   169 LGYDTFDRNFGFLIWFPF---DATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMH 230
            ..: ...:|..|...|||   :.:.:.:.:.|:|...::.|.......||.:.|.:.:..:|...
  Fly   168 PMW-VHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFG 231

  Fly   231 FNYISMRLED-HPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLL----NFLMASMQ 290
            ...:.:.|.. |..|....:..:| ...:::.|.|.:::.:..||::..:|::    ||.:.|:.
  Fly   232 IEVLCLELRQIHRHNYGLQELRME-TNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLS 295

  Fly   291 ICFIAFQVTESTVE--VIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYN-QKWFQCSKS 352
            :    .:..|:..:  |:..:.:.::.::..:.|..|.||.|...||::.:|||. ....:.||.
  Fly   296 V----LEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKD 356

  Fly   353 YCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFALLRTT 400
            ....|.::|.|.|.|..:|...||..:|:.|..:::..|.....|..|
  Fly   357 VYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLLKT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 63/297 (21%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 63/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.