DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or2a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:414 Identity:91/414 - (21%)
Similarity:162/414 - (39%) Gaps:108/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LKSLLFKIYLYAGFINFNLLV--------IGELVFFYNSIQDFETIRLAIAVAPCIGFSLVADFK 95
            :.|||:.:|    .|..||:|        :..|:|..|.....|.:.:.|.       .:||:.|
  Fly    33 VSSLLYVVY----SITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITIT-------DIVANLK 86

  Fly    96 QA--AMIRGK----KTLIMLLD-------DLENMHPKTLAKQMEYKLPDFEKTMKRVINIFTFLC 147
            .|  .|:|.:    ::|:.|:|       |.|.:  ..|.|::...    :.|.:...:||.|  
  Fly    87 FANVYMVRKQLHEIRSLLRLMDARARLVGDPEEI--SALRKEVNIA----QGTFRTFASIFVF-- 143

  Fly   148 LAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFD---ATRNNL---IYWIMYWDIAHGA 206
               .||.|   .::..|:        .||...:..||..|   :|||.:   ||.:.      |.
  Fly   144 ---GTTLS---CVRVVVR--------PDRELLYPAWFGVDWMHSTRNYVLINIYQLF------GL 188

  Fly   207 YLAGI----------AFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNED------------- 248
            .:..|          ||||.          :..|...:.:|:....|.:.:.             
  Fly   189 IVQAIQNCASDSYPPAFLCL----------LTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEV 243

  Fly   249 -KENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIA----FQVTESTVEVIII 308
             :|.||.:..:.|.|    :|.|.:..:.|...:..|:.::...|.:|    :...:.....:||
  Fly   244 YQELIECIRDLARVH----RLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMII 304

  Fly   309 YCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPP 373
            ..:|.....::||::||:||.:...|..:.||.|:..|.:....:...|...:.|:|:|:.|...
  Fly   305 SIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAG 369

  Fly   374 TFPPISLVTYMKVISMSYQFFALL 397
            .:..:||.|:.:|:..:|..|.||
  Fly   370 NYIALSLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 74/351 (21%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 77/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.