DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67c and Or69a

DIOPT Version :9

Sequence 1:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:394 Identity:96/394 - (24%)
Similarity:176/394 - (44%) Gaps:58/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RSTNPLKSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFET-------IRLAIAVAPCIGFSLV 91
            ||....::|..:|..:.|.:|.....||.:::.|  ..|..|       ..|| :||..:||::|
  Fly    28 RSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYGY--FGDGRTKDPIAYLAELA-SVASMLGFTIV 89

  Fly    92 ADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDF-EKTMKRVINIFTFLCLAYTTTFS 155
            .......|:..|.....||::.|.:.  .|.|...|::..: ||..:.:.|.|.|    :|:...
  Fly    90 GTLNLWKMLSLKTHFENLLNEFEELF--QLIKHRAYRIHHYQEKYTRHIRNTFIF----HTSAVV 148

  Fly   156 FYPA--IKASVKFNFLGYDTFDRNFGFLI----WFPFDATRNNLIYWIMYWDIAHG--AYLAGIA 212
            :|.:  |...::.:|    :..:..|:.|    |:|              |.:...  .:.|.:|
  Fly   149 YYNSLPILLMIREHF----SNSQQLGYRIQSNTWYP--------------WQVQGSIPGFFAAVA 195

  Fly   213 F--------LCADLLLVVVIT----QICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDKC 265
            .        :|.::.:..:|.    |:.:||:.::.:||.....:...|:.:::|   |.||.|.
  Fly   196 CQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYL---IVYHTKL 257

  Fly   266 LKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVIIIYCIFLMTSMVQVFMVCYYGDTL 330
            |.|.:.||..::|:.|::..::.:..||:||.:|.......:.:.:.|:..:...|.:|..|..|
  Fly   258 LNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHL 322

  Fly   331 IAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFA 395
            |..|.||..||:...|::....|..||.:|:||:.||...:.....|:|:.|||..:..|||.|.
  Fly   323 ILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFT 387

  Fly   396 LLRT 399
            .:|:
  Fly   388 CVRS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 76/325 (23%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 80/336 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.