DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and GHR1

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001320016.1 Gene:GHR1 / 827842 AraportID:AT4G20940 Length:1037 Species:Arabidopsis thaliana


Alignment Length:444 Identity:114/444 - (25%)
Similarity:176/444 - (39%) Gaps:111/444 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DILAITT----KLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTN-YQENI--TLGEN 190
            |.|.:|.    .|.|....||..:.|.|.::.:.||.....|:|:||||:.| :..::  .:|.:
plant    61 DNLGLTADADFSLFSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRS 125

  Fly   191 ANLRFLSISNNN-----------------------------------LRDFQWCHL--------- 211
            .:||.||:|.||                                   |.|..:.:|         
plant   126 VSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKM 190

  Fly   212 ----RVLPKLEELHLHSNWLE-HLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELL 271
                .::..||.|.||.|.:: :|| |.|:.|.|...:::|.|.|......|.  ||....::.|
plant   191 PRGFELISSLEVLDLHGNSIDGNLD-GEFFLLTNASYVDISGNRLVTTSGKLL--PGVSESIKHL 252

  Fly   272 DYSSNIVKVLDDSVFCRLKKLRTLNLWLNQI-------NRIHPRAFLGLSS-------------- 315
            :.|.|.::....|.|...:.|:.|:|..|.:       |.::....|.||:              
plant   253 NLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELPGFNYVYDLEVLKLSNNRFSGSLPNNLLKG 317

  Fly   316 ----LQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQ-KLGLRVFGERIL------------ 363
                |.||.|.||.:|.....:.:  |.|..||||.|::. :|.|...|..:|            
plant   318 DSLLLTTLDLSGNNLSGPVSSIMS--TTLHTLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNLT 380

  Fly   364 -----RKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLV-SLDLRMFAPLRQLQLLTINEN 422
                 ..:.|||||.|:.....|.|...:.....|.|..|:|. ||..|:.....:|::|.|:.|
plant   381 RWSKWENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSN 445

  Fly   423 RLE-EIDGEILDTLDRLNHLELNNNRLTF----LPDLKSSQNLLQLRNITLEGN 471
            .|| .|.|.:| ::..|..:.|.||.:|.    ||...|...||.|.:...:|:
plant   446 SLEGPIPGALL-SMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566 17/50 (34%)
leucine-rich repeat 128..147 CDD:275380 5/17 (29%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..192 CDD:275380 7/22 (32%)
LRR_RI <187..400 CDD:238064 71/304 (23%)
LRR_8 192..251 CDD:290566 24/107 (22%)
leucine-rich repeat 193..216 CDD:275380 10/70 (14%)
leucine-rich repeat 217..240 CDD:275380 11/23 (48%)
leucine-rich repeat 241..267 CDD:275380 6/25 (24%)
leucine-rich repeat 268..291 CDD:275380 5/22 (23%)
LRR_8 290..350 CDD:290566 22/84 (26%)
leucine-rich repeat 292..315 CDD:275380 7/29 (24%)
leucine-rich repeat 316..339 CDD:275380 7/22 (32%)
LRR_8 340..400 CDD:290566 21/77 (27%)
leucine-rich repeat 340..365 CDD:275380 10/42 (24%)
leucine-rich repeat 366..389 CDD:275380 8/22 (36%)
leucine-rich repeat 390..413 CDD:275380 7/23 (30%)
LRR_8 391..448 CDD:290566 20/58 (34%)
leucine-rich repeat 414..437 CDD:275380 9/23 (39%)
GHR1NP_001320016.1 PLN00113 2..1036 CDD:215061 114/444 (26%)
leucine-rich repeat 80..103 CDD:275380 6/22 (27%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
leucine-rich repeat 128..151 CDD:275380 7/22 (32%)
leucine-rich repeat 152..175 CDD:275380 1/22 (5%)
leucine-rich repeat 176..199 CDD:275380 1/22 (5%)
leucine-rich repeat 200..223 CDD:275380 11/23 (48%)
leucine-rich repeat 224..248 CDD:275380 6/25 (24%)
leucine-rich repeat 249..272 CDD:275380 5/22 (23%)
leucine-rich repeat 296..314 CDD:275380 3/17 (18%)
leucine-rich repeat 344..387 CDD:275380 10/42 (24%)
leucine-rich repeat 388..412 CDD:275380 8/23 (35%)
leucine-rich repeat 413..436 CDD:275380 7/22 (32%)
leucine-rich repeat 437..460 CDD:275380 9/23 (39%)
leucine-rich repeat 461..484 CDD:275380 7/22 (32%)
leucine-rich repeat 485..508 CDD:275380 4/14 (29%)
leucine-rich repeat 509..532 CDD:275380
leucine-rich repeat 533..553 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.