DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and RLP40

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_566757.2 Gene:RLP40 / 822091 AraportID:AT3G24982 Length:915 Species:Arabidopsis thaliana


Alignment Length:601 Identity:155/601 - (25%)
Similarity:225/601 - (37%) Gaps:160/601 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALQVLALLLLSGV-------FGKDLQECEDLGNGSYLCREIESFEQLNRYVGKNWKSVKVVNEHT 60
            :|..|.|||||.|       |...:     :|.|:....:|::|.|.     ||....:..|...
plant    38 SLNFLLLLLLSCVSPSSFFTFNNPV-----VGLGACGPHQIQAFTQF-----KNEFDTRACNHSD 92

  Fly    61 GIERAEDGELPGLSTLLQLDLSESGGVTL-GEKGLQDFKALQKLNLTHAQLDELKSEQFPNPSEM 124
            ........:..|..|:|||....||  || ....|..|..|:.|.|.|        ..|.:.|..
plant    93 PWNGVWCDDSTGAVTMLQLRACLSG--TLKPNSSLFQFHHLRSLLLPH--------NNFTSSSIS 147

  Fly   125 INFDVSYN-DILAITTKLMSGFGNLVYANFS--ENLIAVIEPN-------AF-RHMKNLRFLDLT 178
            ..|.:..| ::|::::   |||...|..:||  ..|.|::..|       :| |:::.||.||::
plant   148 SKFGMLNNLEVLSLSS---SGFLAQVPFSFSNLSMLSALVLSNNDLTGSLSFARNLRKLRVLDVS 209

  Fly   179 TNYQENITLGENANLRFLSISNNNLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRV 243
            .|:             |..|.|.|            ..|.||| |..:|            |||.
plant   210 YNH-------------FSGILNPN------------SSLFELH-HIIYL------------NLRY 236

  Fly   244 LNVSNNNL-FEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHP 307
            .|.::::| :|.        |.:..||:||.|||............|.:|..|.|.||......|
plant   237 NNFTSSSLPYEF--------GNLNKLEVLDVSSNSFFGQVPPTISNLTQLTELYLPLNHFTGSLP 293

  Fly   308 RAFLGLSSLQTLHLQGNKIS-ILPDDVFANLTALEKLDLSKNNIQKLGLRVFGERILRKLIYLDL 371
             ....|:.|..|||.||..| .:|..:| .:..|..|.|..||:.. .:.|.......:|..|.|
plant   294 -LVQNLTKLSILHLFGNHFSGTIPSSLF-TMPFLSYLSLKGNNLNG-SIEVPNSSSSSRLESLHL 355

  Fly   372 SNNYIAD--LHPLALSSMPFIKELRLR-RNRLVSLDLRMFAPLRQLQLL---------------- 417
            ..|:...  |.|  :|.:..:|||.|. .|....:||.:|:.|:.|.||                
plant   356 GENHFEGKILEP--ISKLINLKELDLSFLNTSYPIDLSLFSSLKSLLLLDLSGDWISKASLTLDS 418

  Fly   418 ----TINENRLEEID----GEILDTLDRLNHLELNNNRLT--------FLPDLKS---SQNLL-- 461
                |:...|||..|    ..:..||..|.::.|:|||::        .||.|.|   :.|||  
plant   419 YIPSTLEVLRLEHCDISDFPNVFKTLHNLEYIALSNNRISGKFPEWLWSLPRLSSVFITDNLLTG 483

  Fly   462 -QLRNITLEGNPWQCLCLDEITSWLNGR------HVSYARPSSAYFSGRKPLCVVT--------- 510
             :..:..|..:..|.|.||  |:.|.|.      .::|.......|.|..||.:..         
plant   484 FEGSSEVLVNSSVQILSLD--TNSLEGALPHLPLSINYFSAIDNRFGGDIPLSICNRSSLDVLDL 546

  Fly   511 -------PMDKCLRDL 519
                   |:..||.:|
plant   547 SYNNFTGPIPPCLSNL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 9/23 (39%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR_8 128..180 CDD:290566 17/62 (27%)
leucine-rich repeat 128..147 CDD:275380 5/19 (26%)
leucine-rich repeat 148..171 CDD:275380 8/32 (25%)
leucine-rich repeat 172..192 CDD:275380 5/19 (26%)
LRR_RI <187..400 CDD:238064 59/217 (27%)
LRR_8 192..251 CDD:290566 14/58 (24%)
leucine-rich repeat 193..216 CDD:275380 4/22 (18%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..267 CDD:275380 6/26 (23%)
leucine-rich repeat 268..291 CDD:275380 8/22 (36%)
LRR_8 290..350 CDD:290566 20/60 (33%)
leucine-rich repeat 292..315 CDD:275380 7/22 (32%)
leucine-rich repeat 316..339 CDD:275380 9/23 (39%)
LRR_8 340..400 CDD:290566 18/62 (29%)
leucine-rich repeat 340..365 CDD:275380 6/24 (25%)
leucine-rich repeat 366..389 CDD:275380 7/24 (29%)
leucine-rich repeat 390..413 CDD:275380 9/23 (39%)
LRR_8 391..448 CDD:290566 23/81 (28%)
leucine-rich repeat 414..437 CDD:275380 10/46 (22%)
RLP40NP_566757.2 LRR_RI 97..>263 CDD:238064 59/224 (26%)
LRR_8 130..190 CDD:290566 18/70 (26%)
leucine-rich repeat 131..155 CDD:275380 7/31 (23%)
leucine-rich repeat 156..179 CDD:275380 7/25 (28%)
leucine-rich repeat 180..202 CDD:275380 5/21 (24%)
LRR_8 201..264 CDD:290566 29/108 (27%)
leucine-rich repeat 203..228 CDD:275380 13/50 (26%)
leucine-rich repeat 229..253 CDD:275380 8/43 (19%)
leucine-rich repeat 254..277 CDD:275380 8/22 (36%)
leucine-rich repeat 278..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..324 CDD:275380 9/23 (39%)
leucine-rich repeat 325..349 CDD:275380 6/24 (25%)
leucine-rich repeat 350..371 CDD:275380 7/22 (32%)
LRR_8 422..481 CDD:290566 17/58 (29%)
leucine-rich repeat 424..446 CDD:275380 6/21 (29%)
leucine-rich repeat 447..468 CDD:275380 5/20 (25%)
leucine-rich repeat 471..495 CDD:275380 6/23 (26%)
leucine-rich repeat 517..540 CDD:275380 5/22 (23%)
leucine-rich repeat 541..585 CDD:275380 4/22 (18%)
LRR_8 560..620 CDD:290566 1/3 (33%)
leucine-rich repeat 563..583 CDD:275380 155/601 (26%)
leucine-rich repeat 586..609 CDD:275380
leucine-rich repeat 610..633 CDD:275380
leucine-rich repeat 634..660 CDD:275380
leucine-rich repeat 735..758 CDD:275380
leucine-rich repeat 759..782 CDD:275380
LRR_8 762..817 CDD:290566
leucine-rich repeat 783..806 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.